ECF proteins of ECF subgroup ECF12s1

Displaying ECF 221 - 240 of 2311 in total

>ECFp29977 ECF12 ECF12s1 Actinomyces massiliensis F0489

1 MTDTDDPRPDGAPRADGEAATDLLTEVDPDGSGSLDRAPEDESEEERAAR
51 FEADALPYLDQLYGAAMRMTRNPADAEDLIQDAYARAFASFHQYRPGTNL
101 KAWLYRILTNTFINSYRKKQREPLQSDADAVEDWQLHRAASHDSTGLPSA
151 ENIALDDLPDEEIKAAFSELSEDRRLAVYLADVEGFSYKEIAEIMDTPIG
201 TVMSRLHRGRRQLRELLADHARQLGYTTTREEGR

>ECFp30033 ECF12 ECF12s1 Actinoplanes subtropicus

1 MEYAARGSDDIARVRNLLSSPEWPAAEPSPSSPSVSVSTPAVFEASTGAL
51 PVSSAGRSRGEQRVAQTERTEERRARFERDALPFVDQLYAAGLRMTRNPA
101 DAEDLVQETFLKAYSAFHQFEEGTNLKAWLYRILTNTYINSYRRKQRQPV
151 QAPTEEITDWQLASSESHSSVGLRSAETEALDRLPDSDIKDALQQLPEDF
201 RLAVYLADVEGFSYKEIADIMGTPIGTVMSRLHRGRRNLRKLLEQYAIDR
251 GITRTASEPQEA

Name Aliases LCA Taxa Group Subgroup
ECFp30076
  • RNA polymerase sigma 70
  • DNA-directed RNA polymerase sigma-70 factor
  • ... more
Pseudarthrobacter phenanthrenivorans ECF12 ECF12s1

>ECFp30076 ECF12 ECF12s1 Pseudarthrobacter phenanthrenivorans

1 MTVDKLAAEPPEYGMPRRGSLTVDLKAMSTLDPAVAAMYEASPGELNGGT
51 GIAPLPAGQASPDSPAGEAETDDGTVDISTETVEQRRLRFERDAMQYVDQ
101 LYSAAMRMARNPSDAEDLVQEAYTKAFSAFHQYKPGTNLKAWLYRILTNT
151 YINLYRKRQREPLQSNSDSIEDWQLARAESHTSSGLRSAEAEALDHLPDS
201 DVKRALQDIPEEFRLAVYFADVEGFAYKEISDIMNTPIGTVMSRLHRGRR
251 MLRDMLAEYAAERGFKTAADASDAAGSKAQENRK

>ECFp30111 ECF12 ECF12s1 Microbacterium sp. TNHR37B

1 MIATLPPVSDLFGDVDWRLMENEAATDPRHQFEEQALPFMDQLYAAAMRM
51 TRNPADAADLVQETFVKAFASWASFTQGTNLKAWLYRILTNTYINTYRKK
101 QREPYQGTIDDLEDWQLGGAESTTATRTRSAEAEAIDHMPASAVKDALQE
151 IPEDFRLAVYLADVEGFAYQEIADIMKTPIGTVMSRLHRGRRMLRELLAD
201 YARERGIDVPATRSTR

Name Aliases LCA Taxa Group Subgroup
ECFp30165
  • RNA polymerase sigma factor RpoE
  • AMYNI_RS0123625
Amycolatopsis nigrescens CSC17Ta-90 ECF12 ECF12s1

>ECFp30165 ECF12 ECF12s1 Amycolatopsis nigrescens CSC17Ta-90

1 MTPAVSDEVTAATEQEQADARAERFERDAMPLLDQLYSAAMRMTRNPADA
51 EDLVQETYLKAYNAFASFKEGTNLKAWMYRILTNTYINGYRKRQRQPIQQ
101 PTEEISDWQIAKAESHTSSGLRSAEVEAMDKLPDTDVKAALQQLPEEFRL
151 AVYLADVEGFAYKEIAEIMDTPIGTVMSRLHRGRGQLRELLADVARERGF
201 IRGTKAKQEVAGR

>ECFp30199 ECF12 ECF12s1 Streptomyces

1 MGPVTGTDAGTENGQAEQPEGRGTSTGPAGAPAAESTAERSARFERDALE
51 FLDQMYSAALRMTRNPADAEDLVQETYAKAYASFHQFREGTNLKAWLYRI
101 LTNTFINSYRKKQREPQRSAAEEIEDWQLARAESHMSTGLRSAESQALDH
151 LPDSDVKSALQAIPEEFRIAVYLADVEGFAYKEIADIMGTPIGTVMSRLH
201 RGRRQLRGMLEDYARERGLVPAGAGESNEAKGSGS

>ECFp30263 ECF12 ECF12s1 Microbacterium sp. H83

1 MLATLERGFADLSGLDWPVMDDTAPAASVDDPRREFEEQAIPFMDQLYAA
51 AMRMTRNPADAADLVQETFVKAYGSWSTFTQGTNLKAWLYRILTNTYINM
101 YRKKQREPFQGTIDELEDWQLGGAESTTASHSRSAEAEAIDHMPASVVKD
151 ALQAVPEDFRLAVYLADVEGFAYQEIADIMKTPIGTVMSRLHRGRRMLRE
201 LLADYAAERGISAADPRSRK

>ECFp30293 ECF12 ECF12s1 Streptomyces

1 MGPVTGTDTGTDDGRAPETTAERNARFERDALGFLDQMYSAALRMTRNPA
51 DAEDLVQETYAKAYGSFHQFREGTNLKAWMYRILTNTFINSYRKKQREPQ
101 RSAAEEIEDWQLARAESHMSTGLRSAESQALDHLPDSDVKSALQAIPEEF
151 RIAVYLADVEGFAYKEIADIMGTPIGTVMSRLHRGRRQLRGMLEDYARER
201 GLVAAGAGDSDDRKGSTS

Name Aliases LCA Taxa Group Subgroup
ECFp30300
Rhodococcus opacus B4 ECF12 ECF12s1

>ECFp30300 ECF12 ECF12s1 Rhodococcus opacus B4

1 MSSVIEPTSRLQLAVTLTPTATEGISVQEHDRPTAEKAEPQDELIARFER
51 DALPLLDQLYGAALRMTRNPADAEDLVQETYVKAYTAFRSFREGTNLKAW
101 LYRILTNTYINSYRKKQRQPAQYPTDEITDWQLAATAEHSSTGLRSAEVE
151 ALDALPDDDIKEALQALPEEFRMAVYYADVEGFPYKEIAEIMGTPIGTVM
201 SRLHRGRKQLRGLLADVARERGFNRGGTGDVSGDSVVSAEQEVSR

>ECFp30318 ECF12 ECF12s1 Propionibacterium freudenreichii subsp. shermanii

1 MRDTETDAERAERFERDAMVYIDQLYGAALRMTRNPSDAEDVVQETYAKA
51 FSSFKQFRPGTNLKAWLYRILTNTYINTYRKAQRQPQTGSDDVEDWQLAK
101 AASHDATGLRSAEMEALREMPDAAVTNALEQLSDEFREAVLLADVEGISY
151 KEIAEIMGTPIGTVMSRLNRGRAQLRKLLADYARENGIGGDRNHE

>ECFp30335 ECF12 ECF12s1 Micromonospora sp. NRRL B-16802

1 MERDERDAKQLKRLLDAPAWPATARPGGVGPGGVRAVSTGTPAGSESAGT
51 SVRVSSAGKHPTRGDVRLTTEKTDERRARFERDAMPFVDQLYAAGLRMTR
101 NPADAEDLVQETYLKAYAAFHQFEQGTNLKAWLYRILTNTYINSYRKRQR
151 QPIQAPTEEITDWQLAEAESHTSSGLRSAETEALDRLPDSDVKEALQQLP
201 EEFRLAVYLTDVEGFSYKEVADIMGTPIGTVMSRLHRGRRNLRKLLEQYA
251 AERGFSSARSAKGSTAAAAGREV

>ECFp30376 ECF12 ECF12s1 Mycobacterium sp. 852002-50816_SCH5313054-b

1 MADTDGATGLEGLEAAEPAPPTETDEELTARFERDAIPLLDQLYGGALRM
51 TRNPADAEDLLQETMVKAYAGFRSFRAGTNLKAWLYRILTNTYINSYRKR
101 QRQPAEYPTEEITDWQLAANAEHSSTGLRSAEVEALESLPDNEIKEALQA
151 LPEEFRMAVYYADVEGFPYKEIAEIMDTPIGTVMSRLHRGRRQLRGLLAD
201 VAKERGFTRGQQAHEEVSP

>ECFp30412 ECF12 ECF12s1 Propionibacterium freudenreichii

1 MQTITQPRSSVLSYAMTIPTPATNSSARGASAEPAGDVRDTETDAERAER
51 FERDAMVYIDQLYGAALRMTRNPSDAEDVVQETYAKAFSSFKRFRPGTNL
101 KAWLYRILTNTYINTYRKAQRQPQTGSDDVEDWQLAKAASHDATGLRSAE
151 MEALREMPDAAVTNALEQLSDEFREAVLLADVEGFSYKEIAEIMGTPIGT
201 VMSRLNRGRAQLRKLLADYARENGIGGDRNHE

>ECFp30418 ECF12 ECF12s1 Mycobacterium

1 MADSDDGRDGVTGPEIPEPPAHEETDAELTARFERDAIPLLDQLYGGALR
51 MTRNPADAEDLLQETMVKAYAGFRSFRAGTNLKAWLYRILTNTYINSYRK
101 KQRQPAEYPTEEITDWQLASNAEHSSTGLRSAEVEALEALPDSEIKEALA
151 ALPEEFRMAVYYADVEGFPYKEIAEIMDTPIGTVMSRLHRGRRQLRGLLA
201 DVAKERGFNRGQQTHEEVSS

Name Aliases LCA Taxa Group Subgroup
ECFp30432
  • hypothetical protein
  • EW62_RS06295
Herbiconiux sp. YR403 ECF12 ECF12s1

>ECFp30432 ECF12 ECF12s1 Herbiconiux sp. YR403

1 MAAVALLERPREAFVASDDLRLPVMTTDSTDAEVRGAAKPDLSTLFEEQA
51 LPFIDQLYGAALRMTKNPSDAQDLVQETFVKAFAAFKQFEQGTNLKAWLY
101 RILTNTFINTYRKKQREPYQGTIDELEDWQLGGAESTTASSSRSAEAEAI
151 DHLPDSTVKDALQSLPEDFRMAVYFADVEGFSYQEIAEMMKTPIGTVMSR
201 LHRGRRMLREMLAGYALEQGIGHASTNTGAQASRSKK

>ECFp30410 ECF12 ECF12s1 Mycobacterium tuberculosis

1 MSTATSLLGEKRLARMLARPVSEPVLSGDTANEGTQLIKMADIDGVTGSA
51 GLQPGPSEETDEELTARFERDAIPLLDQLYGGALRMTRNPADAEDLLQET
101 MVKAYAGFRSFRHGTNLKAWLYRILTNTYINSYRKKQRQPAEYPTEQITD
151 WQLASNAEHSSTGLRSAEVEALEALPDTEIKEALQALPEEFRMAVYYADV
201 EGFPYKEIAEIMDTPIGTVMSRLHRGRRQLRGLLADVARDRGFARGEQAH
251 EGVSS

>ECFp30413 ECF12 ECF12s1 Planomonospora sphaerica

1 MLALIEPVARPGDRAFPGERVSSAQYGVPREPDSGDPKGVGPVPATDAET
51 LEQRSERFERDVMPYLDQLYSAALRMTRNPADAEDLLQETFAKAFASFHQ
101 FQEGTNLKAWLYRILTNTFINSYRKKQREPKQAGTEEIEDWQLARAESHT
151 STGLKSAEIEALDHLPDSDVKDALAALPEDFRIAVYLADVEGFPYKEIAE
201 IMGTPIGTVMSRLHRGRRQLRTQLEDYARERGLVPAEGAK

Name Aliases LCA Taxa Group Subgroup
ECFp30424
  • RNA polymerase sigma factor RpoE
  • MKAN_RS20615
Mycobacterium kansasii ECF12 ECF12s1

>ECFp30424 ECF12 ECF12s1 Mycobacterium kansasii

1 MSTATSLLCEERLDRFLASPASPLTLSGDTATEGTVLIKMADIDGETWSE
51 VPGPQPHAETDEQLTARFERDAIPLLDQLYGGALRMTRNPADAEDLLQET
101 MVKAYAGFRSFREGTNLKAWLYRILTNTYINSYRKKQRQPAEYPTEAITD
151 WQLAANAEHSSSGLRSAEVEALEALPDSEIKEALQALPEEFRMAVYYADV
201 EGFPYKEIAEIMDTPIGTVMSRLHRGRRQLRALLADVAKERGFVRGDQPH
251 EEVSS

>ECFp30433 ECF12 ECF12s1 Corynebacterium bouchesdurhonense

1 MPETEPDTAAPDTAAGAVDLKERFTQEAMPLLDQLYGGALRMTRNPQDAE
51 DLVQETYLKAYNAFDSFKPGTNLKAWLYRIMTNTYINTYRKKQRRPLVTS
101 AEDVTDSQLYTSSSHDSTGLESAEVEALKNMPNSRISEALNSINEDYRMV
151 VYYADVEGLAYKEIAEVMDIPLGTVMSRLHRGRKQLRELLKDVAHEQGIG
201 LDREPEEK

>ECFp30421 ECF12 ECF12s1 Streptomyces

1 MGPVTGTDAGTENGQAEQPEGQGGTGAETAAERSARFERDALEFLDQMYS
51 AALRMTRNPADAEDLVQETYAKAYASFHQFREGTNLKAWLYRILTNTFIN
101 SYRKKQREPQRSAAEEIEDWQLARAESHMSTGLRSAESQALDHLPDSDVK
151 QALQAIPEEFRIAVYLADVEGFAYKEIADIMGTPIGTVMSRLHRGRRQLR
201 GMLEDYARERGMVPAGAGESNEAKGSGS

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more