ECF proteins of ECF subgroup ECF12s1

Displaying ECF 2301 - 2311 of 2311 in total

>ECFp178483 ECF12 ECF12s1 Streptomyces sp. CB03234

1 MGPVTGTDTGTDDGHEETTAERNARFERDALEYLDQMYSAALRMTRNPAD
51 AEDLVQETYAKAYGSFHQFREGTNLKAWLYRILTNTFINSYRKKQREPQR
101 SAAEEIEDWQLARAESHMSTGLRSAESQALDHLPDSDVKEALQAIPEEFR
151 IAVYLADVEGFAYKEIADIMGTPIGTVMSRLHRGRRQLRGMLEDYARERG
201 LVPAGAGESSNNGKGSGS

>ECFp140302 ECF12 ECF12s1 Micromonospora yangpuensis

1 MPTETRIRERDAGGAQQLRRLLSGPEWPASASPVEPPAGTGDMVSRGTAG
51 ESESAGRPVRVSSGRKHPTRGDVRLTTEKTDERRARFERDAMPFVDQLYA
101 AGLRMTRNPADAEDLVQETYLKAYAAFHQFEQGTNLKAWLYRILTNTYIN
151 SYRKRQRQPIQAPTEEITDWQLAEAESHTSSGLRSAETEALDRLPDSDVK
201 EALQQLPEEFRLAVYLTDVEGFSYKEVADIMGTPIGTVMSRLHRGRRNLR
251 KLLERYAADRGFSAARSSGGSTAAAGREV

>ECFp140306 ECF12 ECF12s1 Micromonospora

1 MRLTTEKTDERRARFERDAMPFVDQLYAAGLRMTRNPADAEDLVQETYLK
51 AYAAFHQFEQGTNLKAWLYRILTNTYINSYRKRQRQPIQAPTEEITDWQL
101 AEAESHTSSGLRSAETEALDRLPDSDVKEALQQLPEEFRLAVYLTDVEGF
151 SYKEVADIMGTPIGTVMSRLHRGRRNLRKLLEGYAAERGFSAARSPKGST
201 AAAGREV

>ECFp140356 ECF12 ECF12s1 Micromonospora sediminicola

1 MRLTTEKTDERRARFERDAMPFVDQLYAAGLRMTRNPADAEDLVQETYLK
51 AYAAFHQFEQGTNLKAWLYRILTNTYINSYRKRQRQPIQAPTDEITDWQL
101 AEAESHTSSGLRSAETEALDRLPDSDVKEALQQLPEEFRLAVYLTDVEGF
151 SYKEVADIMGTPIGTVMSRLHRGRRNLRKLLEGYAAERGFSAASSKGSTA
201 TAGREV

>ECFp140446 ECF12 ECF12s1 Micromonospora pallida

1 MTTEKTDERRARFERDALPFVDQLYAAALRMTRNPADAEDLLQETFLKAY
51 AAFHQFEQGTNLKAWLYRILTNTYINSYRKRQRQPVQAPTEEITDWQLAE
101 AESHTSSGLRSAETEALDRLPDTDVKEALQQLPEEFRLAVYLTDVEGFSY
151 KEVADIMGTPIGTVMSRLHRGRRNLRKLLERYAAERGFSAARSSGGPTSA
201 GREV

>ECFp140450 ECF12 ECF12s1 Micromonospora chaiyaphumensis

1 MPTETRSRERDERDARRLKGLLDAPDWPATASAVSTSTQSGSESADRWVR
51 VSSASKHPTRGDVRLTTEKTDERRARFERDAMPFVDQLYAAGLRMTRNPA
101 DAEDLVQETYLKAYAAFHQFEQGTNLKAWLYRILTNTYINSYRKRQRQPV
151 QAPTDEITDWQLAEAESHTSSGLRSAETEALDRLPDSDVKEALQQLPEEF
201 RLAVYLTDVEGFSYKEVADIMGTPIGTVMSRLHRGRRNLRKLLEQYAAER
251 GFSAAPSKGSTAAAGREV

>ECFp31609 ECF12 ECF12s1 Micromonospora sp. ATCC 39149

1 MPTETRSREQDEREARQLRRLLGGPEWPVVSLPVEPDRPVIARAVGPGAV
51 RTSTPAESESAGSSRRVSSAGKHPTRGDVRLTTEKTDERRARFERDAMPF
101 VDQLYAAGLRMTRNPADAEDLVQETYLKAYVAFHQFEQGTNLKAWLYRIL
151 TNTYINSYRKRQRQPIQAPTEEITDWQLAEVESHTSSGLRSAETEALDRL
201 PDSDVKEALQQLPEEFRLAVYLTDVEGFSYKEVADIMGTPIGTVMSRLHR
251 GRRNLRKLLEGYAAERGFSAAQSPKGSTAAAGREV

Name Aliases LCA Taxa Group Subgroup
ECFp178876
  • RNA polymerase subunit sigma-70
  • G419_RS24650
Rhodococcus triatomae BKS 15-14 ECF12 ECF12s1

>ECFp178876 ECF12 ECF12s1 Rhodococcus triatomae BKS 15-14

1 MSDQSEGITVPTDPSEPRDSGAAGQADAVPVDSGVEESEAQLTARFERDA
51 LPLLDQLYGAALRMTRNPADAEDLVQETYVKAYSAFRSFKAGTNLKAWLY
101 RILTNTYINSYRKKQRQPAQYPTDEITDWQLAATAEHTSQGLRSAEVEAL
151 DALPDDDIKSALQELPEEFRMAVYYADVEGFPYKEIAEIMGTPIGTVMSR
201 LHRGRKQLRGLLADVARERGFNRGAAEKAAATTGPDQEASR

>ECFp30197 ECF12 ECF12s1 Rhodococcus

1 MVEESVEELTERFERDALPLLDQLYGAALRMTRNPSDAEDLVQETYIKAF
51 SAFRSFREGTNLKAWLYRILTNTYINSYRKRQRQPAQYPTDEITDWQLAA
101 TAEHSSTGLRSAEVEALDALPDDDIKAALQELPEEFRMAVYYADVEGFPY
151 KEIAEIMGTPIGTVMSRLHRGRKQLRGLLADVARDRGFMRGKAVDAATGT
201 TDPAESGKGAAQ

>ECFp178826 ECF12 ECF12s1 Mycobacterium sp. MS1601

1 MPSSIIWTSATEGTVSTKMTDIDDSTGLAPDEKTSVARSDETDAELTARF
51 ERDAIPLLDQLYGGALRMTRNPADAEDLLQETMVKAYSGFRSFREGTNLK
101 AWLYRILTNTYINSYRKKQRQPAEYPTDEITDWQLASNAEHSSTGLRSAE
151 VEALEALPDTEIKEALQALPEEFRMAVYYADVEGFPYKEIAEIMDTPIGT
201 VMSRLHRGRRQLRELLADVARDRGFIRASVDAAEEVSS

>ECFp30628 ECF12 ECF12s1 Mycobacterium sp. 852014-52144_SCH5372336

1 MSVSTSRMSGGGQVPTLAMDFPVLPVDLPGLFAGTATEGTVFPTMTDSDG
51 STRDSAQEAPEPQETDAELTARFERDAIPLLDQLYGGALRMTRNPADAED
101 LLQETMVKAYAGFRSFREGTNLKAWLYRILTNTYINSYRKKQRQPAEYPT
151 EEITDWQLAANAQHSSTGLRSAEVEALESLPDNEIKEALQALPEDFRMAV
201 YYADVEGFPYKEIAEIMDTPIGTVMSRLHRGRRQLRELLADVARDRGFIR
251 GQQMDTPEEVSS

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more