ECF proteins of ECF subgroup ECF12s1

Displaying ECF 2281 - 2300 of 2311 in total
Name Aliases LCA Taxa Group Subgroup
ECFp31512
Herbidospora cretacea ECF12 ECF12s1

>ECFp31512 ECF12 ECF12s1 Herbidospora cretacea

1 MISMTDEQRQAWFERDVVPVTSQLYASAMRLTRNPADAEDLVQETVTKAF
51 TSYHQFREGTNLKAWLHRILTNNFINDYRKKQRSPKLSAAEEIEDWQLAA
101 AESHTSTGLRSAENEALDSLPDNIVMNALRSLPEEFRVAVYLADVEGFAY
151 KEIADRMGTPIGTVMSRLHRGRRQLRGMLEGYAREEGVVREAMAA

>ECFp178728 ECF12 ECF12s1 Modestobacter sp. VKM Ac-2676

1 MPPDSSRTASAAAQPGQREETPEARADGSRSELAESRAQRDARFERDALP
51 YLDQLYPAALRMTRNPADAEDLVQETFVKAYSAFHQFAEGTNLKAWLYRI
101 LTNTYINTYRKKQRQPQQYPTDQVQDWQLYAAEEHTSSGLRSAEIEALDH
151 LPDTDIKEALQQLPEDFRLAVYLADVEGFAYKEIAEIMGTPIGTVMSRLH
201 RGRRGLQKLLADYARERGFVRAGAAEEATRS

>ECFp178787 ECF12 ECF12s1 Geodermatophilus africanus

1 MVTRVRAPQRGRSVPEESADRTPETTPADPVEATAPVEVPEAREGGSRTE
51 VDETRAERDARFERDALPYLDQLYPAALRMTRNPADAEDLVQETFVKAYS
101 AFHQFAEGTNLKAWLYRILTNTYINSYRKKQRQPQQYPTDQVQDWQLYAA
151 EEHSSSGLRSAEIEALDHLPDSDIKEALQQLPEDFRLAVYLADVEGFAYK
201 EIAEIMGTPIGTVMSRLHRGRRGLQKLLADYARERGFVRAGAGEEASQS

>ECFp140258 ECF12 ECF12s1 Streptomyces sp. WMMB 322

1 MTETKGAVSMGSVACPQRPKAADLDWATVALAGGTVTGAARGAERRLFSD
51 SGGSAIGLAVAPEEVGPVTGTEDGENAGQETEAERSARFERDALNYLDQM
101 YSAGLRMTRNPADAEDLVQETYAKAYASFHQFREGTNLKAWLYRILTNTF
151 INSYRKKQREPQRSAAEDIEDWQLARAESHMSTGLRSAEAQALDHLPDSD
201 VKEALQAIPEEFRIAVYLADVEGFAYKEIADIMGTPIGTVMSRLHRGRRQ
251 LRDMLEDYARDRGLAPAGAAQSHNGKGSGS

>ECFp140262 ECF12 ECF12s1 Streptomyces sp. MUSC 1

1 MGPVTGTDAGTDNGQAEQPEGRGVSAETTAESSTQRSARFERDALEFLDQ
51 MYSAALRMTRNPADAEDLVQETYAKAYASFHQFREGTNLKAWLYRILTNT
101 FINSYRKKQREPQRSAAEEIEDWQLARAESHMSTGLRSAESQALDHLPDS
151 DVKEALQAIPEEFRIAVYLADVEGFAYKEIADIMGTPIGTVMSRLHRGRR
201 QLRGMLEDYARERGLVPAGAGESNEAKGSGS

>ECFp178552 ECF12 ECF12s1 Streptomyces prasinopilosus

1 MGSTFCPSRKGRTDLDWTVLHAARTVPLRAADGPDRRLSSDSGEAVPGLA
51 TTEEVGPVPGTDAGTDHGQAEQPEGQGDGRAESAAERSARFERDALEFLD
101 QMYSAALRMTRNPADAEDLVQETYAKAYASFHQFREGTNLKAWLYRILTN
151 TFINSYRKKQREPQRSGAEEIEDWQIARAASHMSTGLRSAESQALDHLPD
201 SDVKEALQAIPEEFRIAVYLADVEGFAYKEIADIMGTPIGTVMSRLHRGR
251 RQLRGMLEDYARERGLVPAGAGGSNEAKGSRS

>ECFp30017 ECF12 ECF12s1 Streptomyces

1 MGPVTGTDAGTEHGQAEQPEGRGTGAESTAERSARFERDALEFLDQMYSA
51 ALRMTRNPADAEDLVQETYAKAYASFHQFREGTNLKAWLYRILTNTFINS
101 YRKKQREPQRSAAEEIEDWQLARAESHMSTGLRSAESQALDHLPDSDVKE
151 ALQAIPEEFRIAVYLADVEGFAYKEIADIMGTPIGTVMSRLHRGRRQLRG
201 MLEDYARDRGLVPAGAGKSNEAKGSGS

Name Aliases LCA Taxa Group Subgroup
ECFp30089
  • RNA polymerase subunit sigma
  • Spa2297_22055
  • ... more
Streptomyces parvulus ECF12 ECF12s1

>ECFp30089 ECF12 ECF12s1 Streptomyces parvulus

1 MGPVTGTDAGTEHGQAEQPEGRGESAESTAERSARFERDALEFLDQMYSA
51 ALRMTRNPADAEDLVQETYAKAYASFHQFREGTNLKAWLYRILTNTFINS
101 YRKKQREPQRSAAEEIEDWQLARAESHMSTGLRSAESQALDHLPDSDVKQ
151 ALQAIPEEFRIAVYLADVEGFAYKEIADIMGTPIGTVMSRLHRGRRQLRG
201 MLEDYARDRGLVPAGAGESNEAKGSGS

>ECFp30135 ECF12 ECF12s1 Streptomyces

1 MGPVPGTDAGTEHGQAEQPEGQGDKRVESTAERSARFERDALEFLDQMYS
51 AALRMTRNPADAEDLVQETYAKAYASFHQFREGTNLKAWLYRILTNTFIN
101 SYRKKQREPLRSGSEEIEDWQIARAASHMSTGLRSAEAQALDHLPDSDVK
151 EALQAIPEEFRIAVYLADVEGFAYKEIADIMGTPIGTVMSRLHRGRRQLR
201 GMLEDYARERGLVPAGAGESNEAKGSRS

>ECFp30139 ECF12 ECF12s1 Streptomyces sp. NRRL S-37

1 MGPVPGTDAGTEHGQAEQPEGQGSTGAESTTERSARFERDALEFLDQMYS
51 AALRMTRNPADAEDLVQETYAKAYASFHQFREGTNLKAWLYRILTNTFIN
101 SYRKKQREPQRSAAEEIEDWQLARAESHMSTGLRSAESQALDHLPDSDVK
151 EALQAIPEEFRIAVYLADVEGFAYKEIADIMGTPIGTVMSRLHRGRRQLR
201 GMLEDYARERGLVPAGAGESNEAKGSGS

>ECFp30406 ECF12 ECF12s1 Streptomyces sp. CNH099

1 MGLVTGTDTGKGEPADERKAPEETSTERNARFERDALQFLDQMYSAALRM
51 TRNPADAEDLVQETYAKAYASFHQFREGTNLKAWLYRILTNTFINSYRKK
101 QREPQRSAAEEIEDWQLARAESHMSTGLRSAEAQALDHLPDSDVKEALQA
151 IPEEFRIAVYLADVEGFAYKEIADIMGTPIGTVMSRLHRGRRQLRGLLED
201 YAQERGLMPAGAGPESAGSHTGKGSGS

Name Aliases LCA Taxa Group Subgroup
ECFp30676
Streptomyces azureus ECF12 ECF12s1

>ECFp30676 ECF12 ECF12s1 Streptomyces azureus

1 MGPVTGTDAGTEHGQAEQPEGQGGTGAETAAERNARFERDALEFLDQMYS
51 AALRMTRNPADAEDLVQETYAKAYASFHQFREGTNLKAWLYRILTNTFIN
101 SYRKKQREPQRSAAEEIEDWQLARAESHMSTGLRSAESQALDHLPDSDVK
151 AALQAIPEEFRIAVYLADVEGFAYKEIADIMGTPIGTVMSRLHRGRRQLR
201 GMLEDYARDRGMVPAGAGESNEAKGSGS

Name Aliases LCA Taxa Group Subgroup
ECFp30678
  • RNA polymerase sigma factor RpoE
  • AAW13_RS19835
Streptomyces humi ECF12 ECF12s1

>ECFp30678 ECF12 ECF12s1 Streptomyces humi

1 MGPVTGTDAGTDNGQAELPEGQGTGAESTSERTARFERDALEFLDQMYSA
51 ALRMTRNPADAEDLVQETYAKAYASFHQFREGTNLKAWLYRILTNTFINS
101 YRKKQREPQRSAAEEIEDWQLARAESHMSTGLRSAESQALDHLPDSDVKE
151 ALQAIPEEFRIAVYLADVEGFAYKEIADIMGTPIGTVMSRLHRGRRQLRG
201 MLEDYARERGLVPAGAGESNEAKGSGS

>ECFp30702 ECF12 ECF12s1 Streptomyces

1 MGPVPGTDAGTEHGQAEQPEGQGSRGAETTAERSARFERDALEFLDQMYS
51 AALRMTRNPADAEDLVQETYAKAYGSFHQFREGTNLKAWLYRILTNTFIN
101 SYRKKQREPQRSAAEEIEDWQLARAESHMSTGLRSAESQALDHLPDSDVK
151 EALQAIPEEFRIAVYLADVEGFAYKEIADIMGTPIGTVMSRLHRGRRQLR
201 GMLEDYARERGLVPAGAGESNEAKGSGS

>ECFp31268 ECF12 ECF12s1 Streptomyces sp. NRRL WC-3618

1 MGPVTGTDAGTEHGQAEQPEGPGRSESTVERSARFERDALEFLDQMYSAA
51 LRMTRNPADAEDLVQETYAKAYASFHQFREGTNLKAWLYRILTNTFINSY
101 RKKQREPQRSAAEEIEDWQLARAESHMSTGLRSAESQALDHLPDSDVKEA
151 LQAIPEEFRIAVYLADVEGFAYKEIADIMGTPIGTVMSRLHRGRRQLRGM
201 LEDYARDRGLVPAGAGESNEAKGSGS

Name Aliases LCA Taxa Group Subgroup
ECFp31381
  • RNA polymerase sigma factor RpoE
  • SSP08S_RS34090
Streptomyces ECF12 ECF12s1

>ECFp31381 ECF12 ECF12s1 Streptomyces

1 MGPVPGTDAGTEHGQAEQPEGQGTSTESTAERSARFERDALEFLDQMYSA
51 ALRMTRNPADAEDLVQETYAKAYASFHQFREGTNLKAWLYRILTNTFINS
101 YRKKQREPQRSAAEEIEDWQLARAESHMSTGLRSAESQALDHLPDSDVKE
151 ALQAIPEEFRIAVYLADVEGFAYKEIADIMGTPIGTVMSRLHRGRRQLRG
201 MLEDYARDRGLVPAGAGESNEAKGSGS

Name Aliases LCA Taxa Group Subgroup
ECFp31562
Streptomyces iakyrus ECF12 ECF12s1

>ECFp31562 ECF12 ECF12s1 Streptomyces iakyrus

1 MGPVTGTDAGTDNGQAEQPEGQGGTGAETTTERNARFERDALEFLDQMYS
51 AALRMTRNPADAEDLVQETYAKAYASFHQFREGTNLKAWLYRILTNTFIN
101 SYRKKQREPQRSAAEEIEDWQLARAESHMSTGLRSAESQALDHLPDSDVK
151 EALQAIPEEFRIAVYLADVEGFAYKEIADIMGTPIGTVMSRLHRGRRQLR
201 GMLEDYARDRGMVPAGAGESNEAKGSGS

>ECFp31612 ECF12 ECF12s1 Streptomyces ambofaciens ATCC 23877

1 MASAFCPSRSSRADLDWTVLHAAKTAPVRATGGPDRQASPAAGQAPSTVG
51 QAFPTAGRLSSDSSGAAFGSVTSLEEVGPVTGTDAGTEHGQAEQPEGRGT
101 GAESTAERSARFERDALEFLDQMYSAALRMTRNPADAEDLVQETYAKAYA
151 SFHQFREGTNLKAWLYRILTNTFINSYRKKQREPQRSAAEEIEDWQLARA
201 ESHMSTGLRSAESQALDHLPDSDVKQALQAIPEEFRIAVYLADVEGFAYK
251 EIADIMGTPIGTVMSRLHRGRRQLRGMLEDYARDRGLVPAGAGESNEAKG
301 SGS

>ECFp31705 ECF12 ECF12s1 Streptomyces prunicolor NBRC 13075

1 MGPVPGTDAGTEHGQAEQPEGQGTSTESTTERSARFERDALEFLDQMYSA
51 ALRMTRNPADAEDLVQETYAKAYASFHQFREGTNLKAWLYRILTNTFINS
101 YRKKQREPQRSAAEEIEDWQLARAESHMSTGLRSAESQALDHLPDSDVKE
151 ALQAIPEEFRIAVYLADVEGFAYKEIADIMGTPIGTVMSRLHRGRRQLRG
201 MLEDYARDRGLVPAGAGESNEAKGSGS

Name Aliases LCA Taxa Group Subgroup
ECFp31747
Streptomyces galbus ECF12 ECF12s1

>ECFp31747 ECF12 ECF12s1 Streptomyces galbus

1 MGPVTGTDAGTERGQAEQPEGTETAADRSARFERDALEFLDQMYSAALRM
51 TRNPADAEDLVQETYAKAYASFHQFREGTNLKAWLYRILTNTFINSYRKK
101 QREPQRSAAEEIEDWQLARAESHMSTGLRSAESQALDHLPDSDVKAALQA
151 IPEEFRIAVYLADVEGFAYKEIADIMGTPIGTVMSRLHRGRRQLRGMLED
201 YARDRGLVPAGAGESNEAKGSGS

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more