ECF proteins of ECF subgroup ECF12s1

Displaying ECF 2241 - 2260 of 2311 in total

>ECFp31231 ECF12 ECF12s1 Nocardia inohanensis NBRC 100128

1 MDEVGDGDETGARSTESTAELARRFERDALPLLDQLYGAALRMTRNPADA
51 EDLVQETFAKAYQGFKSFREGTNLRAWLYRILTNTYINSYRKKQRQPAQY
101 PTDEITDWQLAATAEHTSTGLRSAEMEALEALPDDDIKHALQELPEEFRM
151 AVYYADVEGFPYKEIAEIMGTPIGTVMSRLHRGRKQLKGLLADVARERGF
201 NRSGSDARQEVTQ

>ECFp31410 ECF12 ECF12s1 Nocardia salmonicida NBRC 13393

1 MPQGARLPVDSVVPVDSATTAIEGIGVASDDDVVSDGASGTEVDEAELAA
51 RFERDALPMIDQLYGAALRMTRNPADAEDLVQETFVKAFQGFKSFREGTN
101 LRAWLYRILTNTYINSYRKKQRQPAQYPTDEITDWQLAATAEHSSVGLRS
151 AEVEALDALPDDQIKSALQQLPEEFRMAVYYADVEGFPYKEIADIMGTPI
201 GTVMSRLHRGRKQLKGLLADVARERGFDRGERQEVVK

Name Aliases LCA Taxa Group Subgroup
ECFp31682
  • hypothetical protein
  • O3I_RS35105
Nocardia ECF12 ECF12s1

>ECFp31682 ECF12 ECF12s1 Nocardia

1 MTSDDDVVTDGVGAAAVDDTELAQRFERDALPLLDQLYGAALRMTRNPAD
51 AEDLVQETYVKAFQGFKSFKEGTNLRAWLYRILTNTYINSYRKKQRQPAQ
101 YPTDEITDWQLAATAEHTSQGLRSAEVEALDALPDDDIKAALQELPEEFR
151 MAVYYADVEGFPYKEIADIMGTPIGTVMSRLHRGRKQLKGLLADVARERG
201 FNRSGERQEVKQ

>ECFp30281 ECF12 ECF12s1 Mycobacterium sp. E1747

1 MADSDGATAQEIAEPGPQETDAELMARFERDAIPLLDQLYGGALRMTRNP
51 ADAEDLLQETMVKAYAGFRSFRAGTNLKAWLYRILTNTYINSYRKRQRQP
101 AEYPTEEITDWQLASNAEHSSTGLRSAEVEALEALPDDEIKEALQALPEE
151 FRMAVYYADVEGFPYKEIAEIMDTPIGTVMSRLHRGRRQLRALLADVAKE
201 RGFNRGHQAHEEVSS

>ECFp30602 ECF12 ECF12s1 Mycobacterium sp. E3251

1 MSAATSLLDSPTGAEQLACFLASSAALSVLPGDTAAEGTGVLDMADTDGA
51 TAQEIPDPAPPETDAELMARFERDAIPLLDQLYGGALRMTRNPADAEDLL
101 QETVVKAYAGFRSFRAGTNLKAWLYRILTNTYINSYRKRQRQPAEYPTEE
151 ITDWQLASNAEHSSTGLRSAEVEALEALPDNEIKEALQALPEEFRMAVYY
201 ADVEGFPYKEIAEIMDTPIGTVMSRLHRGRRQLRGLLADVAKERGFNRGH
251 QAHEEVSS

>ECFp30977 ECF12 ECF12s1 Mycobacterium colombiense

1 MADSEDGREGATGPEIPEPAAHEETDAELTARFERDAIPMLDQLYGGALR
51 MTRNPADAEDLLQETMVKAYAGFRSFRAGTNLKAWLYRILTNTYINSYRK
101 KQRQPAEYPTEEITDWQLAANAEHSSTGLRSAEVEALEALPDSEIKEALA
151 ALPEEFRMAVYYADVEGFPYKEIAEIMDTPIGTVMSRLHRGRRQLRGLLA
201 DVAKERGFNRGQQTHEEVSS

Name Aliases LCA Taxa Group Subgroup
ECFp31542
  • RNA polymerase subunit sigma-24
  • A3E1_RS0132845
Catelliglobosispora koreensis DSM 44566 ECF12 ECF12s1

>ECFp31542 ECF12 ECF12s1 Catelliglobosispora koreensis DSM 44566

1 MPFVDQLYAAALRMTRNPADAEDLVQETFLKAFAAFHQFEEGTNLKAWLY
51 RILTNTFINSYRKKQRQPVQAPTDEITDWQLAEAESHTSSGLKSAETEAL
101 ERLPDSDVKEALQSLPEEFRLAVYLADVEGFSYKEVADIMGTPIGTVMSR
151 LHRGRRNLRKLLEGYAIEHGLSREAIND

Name Aliases LCA Taxa Group Subgroup
ECFp31312
  • RNA polymerase sigma factor RpoE
  • putative RNA polymerase sigma factor
  • ... more
Propionibacteriaceae ECF12 ECF12s1

>ECFp31312 ECF12 ECF12s1 Propionibacteriaceae

1 MITRESEDRMDRRVDASGTVDVAEETKTQRAQRFERDALEYLDQLYGAAL
51 RMTRNPADAEDVVQEAYAKAFSSFHQFRPGTNLKAWLYRILTNTYINSYR
101 KAQRRPQTSDDQDVEDWQIAKAASHDSNGLRSAELEALDGLPDQQILDAL
151 DGLSDEFRQVVLLADVEGFAYKEIAEIMGTPMGTVMSRLNRARKQLRKQL
201 VDVAGARGIGPRAGQVDEEDLGRSAMARTAGREG

Name Aliases LCA Taxa Group Subgroup
ECFp140301
  • RNA polymerase sigma factor RpoE
  • C892_RS0105125
Nocardiopsis ECF12 ECF12s1

>ECFp140301 ECF12 ECF12s1 Nocardiopsis

1 MTTIEMERTAPHAEEQKGLDFAEAVTPYADQLYPTALRMTRNAADAEDLV
51 QETFAKAFANFHQFRAGTNLRAWLYRILTNTFINGYRKKQREPRQDSTDE
101 IKDWQLAAAEAHTSTGARSAEAEVLDHMPDSDIRSALAALPEEFRLVVYL
151 VDVEGFPYKEVAARMGTPLGTVMSRLHRARRQLREQLGHYARERGAGAAA

Name Aliases LCA Taxa Group Subgroup
ECFp29941
  • hypothetical protein
  • ASE16_04360
  • ... more
Leifsonia sp. Root227 ECF12 ECF12s1

>ECFp29941 ECF12 ECF12s1 Leifsonia sp. Root227

1 MTLTSTVLDSPRVHTRAELDLPVMTTATDDLGPLFEEQALQYMDQLYAAA
51 LRMTRNPADAQDLVQETFVKAYAAFNQFQQGTNLKAWLYRILTNTFINTY
101 RKKQREPYQGTIDELEDWQLGGAESTTASSSRSAEAEAIDHLPDSAVKDA
151 LQAIPEDFRMAVYFADVEGFSYQEIADIMKTPIGTVMSRLHRGRRMLREL
201 LTDYAHERGLSAVQTPRSTK

Name Aliases LCA Taxa Group Subgroup
ECFp31120
  • hypothetical protein
  • IE92_RS0112920
Mycetocola saprophilus ECF12 ECF12s1

>ECFp31120 ECF12 ECF12s1 Mycetocola saprophilus

1 MSEDEVSQNPPAGDDPRALFEEQALPFLDQLYGAAMRMTKNPPDAQDLVQ
51 ETFVKAYAAFGQFRQGTNLKAWLYRILTNTYINQYRKKQREPYQGTIDDL
101 EDWQLGGAESTTARASRSAEAEAIDRMPDSAVKEALQAIPEDFRLAVYLA
151 DVEGFAYQEIADIMKTPVGTVMSRLHRGRRLLRELLADYAIERGISIPSE
201 ARSGQ

>ECFp31543 ECF12 ECF12s1 Agromyces sp. Root1464

1 MDATPTDPEAAETSDPGASDSEAAARPLSELFEEQALPFIDQLYAAALRM
51 TKNPADAQDLVQETFVKAFGAFGQFTQGTNLKAWLYRILTNTFINSYRKK
101 QREPYQGTIDDLEDWQLGGAESTTARASRSAEAEAIDHLPDSAVKDALQA
151 LPEDFRLAVYFADVEGFSYQEIADMMNTPIGTVMSRLHRGRRLLRESLAD
201 YAREQGFAAGEKSAKPTRSTK

Name Aliases LCA Taxa Group Subgroup
ECFp31927
  • hypothetical protein
  • ASF88_11705
  • ... more
Leifsonia sp. Leaf336 ECF12 ECF12s1

>ECFp31927 ECF12 ECF12s1 Leifsonia sp. Leaf336

1 MRPHRRIAQRRAQLDWPLMSTETEDKGALFEEQALPFMDQLYAAALRMTR
51 NPADAQDLVQETYVKAYAAFAQFQQGTNLKAWLYRILTNTFINTYRKKQR
101 EPYQGTIDELEDWQLGGAESTTASSSRSAEAEAIDHLPDSAVKDALQAIP
151 EDFRLAVYLADVEGFSYQEIADIMKTPIGTVMSRLHRGRRMLRELLTDYA
201 HERGLSAVQSPDVQTTRRTK

>ECFp178600 ECF12 ECF12s1 Arthrobacter crystallopoietes

1 MPLATLQPAAGLQLRLDRARKTSSVDLVPMTTDKSDEAAPLEVAEESAPA
51 AAADTETPEERSARFERDAMQYVDQLYSAAMRMARNPSDAEDLVQEAYTK
101 AFSAFHQYKPGTNLKAWLYRILTNTYINLYRKRQREPLQSNADQVEDWQM
151 FQAASHTSTGLRSAEAEALDHLPDSDVKEALQAIPEEFRLAVYFSDVEGF
201 AYKEISEIMNTPIGTVMSRLHRGRKLLRDLLADYAHERGMGKKTDKTSVG
251 TKQENGK

>ECFp30384 ECF12 ECF12s1 Micrococcaceae

1 MTLVKDRMVLPEAGYGVQPDSPKLTVDLATMSTIEPAAAAMYEAADATDD
51 DNAPAPAAVDVAAESPEQRRERFERDAMQYVDQLYSAAMRMARNPSDAED
101 LVQEAYTKAFSAFHQYKPGTNLKAWLYRILTNTYINLYRKRQREPLQSNS
151 DTIEDWQLAKAESHTSAGLRSAEAEALDHLPDSDVKNALQAIPEEFRLAV
201 YFADVEGYAYKQISEIMNTPIGTVMSRLHRGRKMLRDMLADYAAERGFKA
251 HTEDQAAAGSNNQEKEK

Name Aliases LCA Taxa Group Subgroup
ECFp30909
  • RNA polymerase
  • CITRI_RS17005
Citricoccus sp. CH26A ECF12 ECF12s1

>ECFp30909 ECF12 ECF12s1 Citricoccus sp. CH26A

1 METHKTAQAPSEHDDPEVDVTAESDAARRQRFERDALEYVDQLYSAAMRM
51 TRNPQDAEDLVQEAYTKAYSSFHQYRPGTNLKAWLYRILTNTYINLYRKR
101 QRQPQQAATDTVEDWQMAKAAQHTSTGLRSAETEALDHLPDSDVKDALQA
151 IPEEFRLAVYFADVEGFAYKEIAEILDIPIGTVMSRLHRGRKLLRGLLTD
201 YARERGIKVEPKTPKTPKAAPKKGGTKTTTSKNAESDAGATGGTEEQEAG
251 R

Name Aliases LCA Taxa Group Subgroup
ECFp178793
Tersicoccus sp. Bi-70 ECF12 ECF12s1

>ECFp178793 ECF12 ECF12s1 Tersicoccus sp. Bi-70

1 MPVLEATPVDWATMTSAPRTPPPAAGAAASDAPTDSPDVDVASETADERR
51 ARFERDALQYVDQLYSAALRMARNPADAEDLVQEAYAKAFSAFHQYKPGT
101 NLKAWLYRILTNTYINLYRKRQREPQQSQSENIEDWQIARAESHTSTGLR
151 SAEAEALDHLPDSDVKRALQEIPEDFRLAVYLSDVEGFAYKEISEIMGTP
201 IGTVMSRLHRGRRLLREKLSDYAVDRGMKVSSTKEKTT

Name Aliases LCA Taxa Group Subgroup
ECFp140222
  • RNA polymerase sigma factor RpoE
  • RNA polymerase subunit sigma-70
  • ... more
Curtobacterium flaccumfaciens UCD-AKU ECF12 ECF12s1

>ECFp140222 ECF12 ECF12s1 Curtobacterium flaccumfaciens UCD-AKU

1 MLTAVPTTLGTLGLDLAAMTTDEPQAAPHHLVDETEVQLDAVEDEQTALD
51 EAADEPVDAKTVSEAELRSLFEDQALPFMDQLYGAAMRMTRNPADASDLV
101 QETFVKAFAAFRQFKQGTNLKAWLYRILTNTFINTYRKNQRNPYQGTIDE
151 LEDWQLGGAESVTQSISARSAEADAIDHLPSSAVKDALQAIPEDFRMAVY
201 FADVEGFSYQEIADIMKTPVGTVMSRLHRGRRLLRGLLADHARETGIVPD
251 AASTATMRGRGRGAASTTKATAATGRSGRKDAR

>ECFp140224 ECF12 ECF12s1 Curtobacterium sp. MCBA15_005

1 MLTAVPTTLGTLGLDLAAMTTDEPQAAPHHLVDETEVQLDAVEEEREALD
51 DAADEPVDAKTVSEGELRSLFEDQALPFMDQLYGAAMRMTRNPADASDLV
101 QETFVKAFAAFRQFKQGTNLKAWLYRILTNTFINTYRKNQRNPYQGTIDE
151 LEDWQLGGAESVTQSISARSAEADAIDHLPSSAVKDALQAIPEDFRMAVY
201 FADVEGFSYQEIADIMKTPVGTVMSRLHRGRRLLRGLLADHARETGIVPD
251 AASTATMRGRGRGAAQTTKATAATGRTGRKDAR

>ECFp140225 ECF12 ECF12s1 Curtobacterium sp. MCBA15_013

1 MREDEAGDREDEASDREDEASDDEAGDDEATAVDVVDAKTVSEAELRSLF
51 EDQALPFMDQLYGAAMRMTRNPADASDLVQETFVKAFAAFRQFKQGTNLK
101 AWLYRILTNTFINTYRKNQRNPYQGTIDELEDWQLGGAESVTQSISARSA
151 EADAIDHLPSSAVKDALQAIPEDFRMAVYFADVEGFSYQEIADIMKTPVG
201 TVMSRLHRGRRLLRGLLADHARETGIVPDAASTATMRGRGRKVAAASSRV
251 EGKEAR

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more