ECF proteins of ECF subgroup ECF12s1

Displaying ECF 2201 - 2220 of 2311 in total

>ECFp140376 ECF12 ECF12s1 Actinoplanes philippinensis

1 MAQKERTEERRARFEREALPFVDQLYAAGLRMTRNPADAEDLVQETFLKA
51 FSAFHQFEQGTNLKAWLYRILTNTYINSYRRKQRQPVQAPTEEITDWQLA
101 SSESHTSQGLRSAETEALDRLPDSDIKEALQSLPEDFRLAVYLADVEGFS
151 YKEIADIMGTPIGTVMSRLHRGRRNLRKLLEQYAVDRGITRTATSEPQGA

>ECFp178461 ECF12 ECF12s1 Actinobacteria bacterium 13_1_20CM_3_71_11

1 MAQSERTDQRRARFERDALPFVDQLYAAALRMTRNPADAEDLVQETFLKA
51 FAAFHQFEEGTNLKAWLYRILTNTYINSYRRRQRQPIQAPTDEISDWQLA
101 SAESHTSSGLRSAETEALDRLPDSDVKEALQSLPEDFRLAVYLADVEGFS
151 YKEIADIMGTPIGTVMSRLHRGRRNLRRLLEGYAADRGLLRGGSDLPVDA
201 PAGQEV

>ECFp178727 ECF12 ECF12s1 Couchioplanes caeruleus subsp. caeruleus

1 MRGGTEFAEREGQQSRRVRDLLCSPEWPAVSPPPVPPSVSVSTPAVFESA
51 NGALPVSSTRSRGEMRVTPTERVERSGRGERTDERRARFERDALPFVDQL
101 YAAGLRMTRNPADAEDLVQETFLKAFSAFHQFEEGTNLKAWLYRILTNTY
151 INSYRRKQRQPVQAPTEEISDWQLASSESHTSAGLRSAETEALDRLPDSD
201 IKDALQQLPEEFRLAVYLADVEGFSYKEIADIMGTPIGTVMSRLHRGRRN
251 LRKLLERYAVDRGITRSSSTPAAQEA

Name Aliases LCA Taxa Group Subgroup
ECFp29989
  • RNA polymerase sigma factor RpoE
  • RNA polymerase sigma-E factor
  • ... more
Actinoplanes sp. SE50/110 ECF12 ECF12s1

>ECFp29989 ECF12 ECF12s1 Actinoplanes sp. SE50/110

1 MAEGVSVVRTGTERGMRERREATRVRELLDAPEWPATEPAPAAAPVSVST
51 PVFESVTGALPVSSAGRSRGESRVAQKERVDERRERFERDALPFVDQLYA
101 AGLRMTRNPADAEDLVQETFLKAFSAFHQFEEGTNLKAWLYRILTNTYIN
151 SYRRKQRQPLQSPTEEITDWQLASSESHTSTGLRSAETEALDRLPDSDIK
201 EALQSLPEDFRLAVYLADVEGFSYKEIADIMGTPIGTVMSRLHRGRRNLR
251 QLLVGYAADRGITRAASEPQEA

>ECFp30181 ECF12 ECF12s1 Actinoplanes awajinensis subsp. mycoplanecinus

1 MKTEHRGTTTRVRDLLDSPEWPAVESPPVASLVSVSTPVFEGVSGALPVS
51 SAGRSRGESRVAQKERTDERRERFERDALPFVDQLYAAGLRMTRNPADAE
101 DLVQETFLKAFSAFHQFEQGTNLKAWLYRILTNTYINSYRKKQRQPLQSP
151 TEEITDWQLASSESHTSSGLRSAETEALDRLPDSDIKEALQSLPEDFRLA
201 VYLADVEGFSYKEIADIMGTPIGTVMSRLHRGRRNLRKLLEQYAVGRGIT
251 RTAAEPQEA

Name Aliases LCA Taxa Group Subgroup
ECFp30881
  • RNA polymerase subunit sigma-24
  • WH85_RS36110
Actinoplanes rectilineatus ECF12 ECF12s1

>ECFp30881 ECF12 ECF12s1 Actinoplanes rectilineatus

1 MGTGAECVERDGREANRVRTLLRSPEWPAVGTPSVSVSTPGVFAGVSRAV
51 PVSSAGRSRGESRVAQKERTDERRARFERDALPFVDQLYAAGLRMTRNPA
101 DAEDLVQETFLKAFSAFHQFEEGTNLKAWLYRILTNTYINSYRRKQRQPV
151 QAPTEEITDWQLASSESHTSQGLRSAETEALDRLPDSDVKEALQSLPEDF
201 RLAVYLADVEGFSYKEIADIMGTPIGTVMSRLHRGRRNLRNLLEGYAVDR
251 GITRTATSGPQGA

Name Aliases LCA Taxa Group Subgroup
ECFp31328
  • RNA polymerase sigma factor RpoE
  • putative RNA polymerase ECF-subfamily sigma factor
  • ... more
Actinoplanes missouriensis 431 ECF12 ECF12s1

>ECFp31328 ECF12 ECF12s1 Actinoplanes missouriensis 431

1 MGAGTEIVERDGREVARVQSLLSSPEWPAAETQPLSSSVSVSTPAVFEGV
51 TRALPVSSAGRSRGESRVAQKERTDERRQRFERDALPFVDQLYAAGLRMT
101 RNPADAEDLVQETFLKAFSAFHQFEEGTNLKAWLYRILTNTYINSYRRKQ
151 RQPVQAPTEEITDWQLASSESHTSSGLRSAETEALDRLPDSDIKEALQSL
201 PEDFRLAVYLADVEGFSYKEIADIMGTPIGTVMSRLHRGRRNLRNLLENY
251 ASDRGITRATTSEPQGA

>ECFp140285 ECF12 ECF12s1 Mycobacterium sp. UM_WWY

1 MPTVCLERPIDIGQFGGAATEGTVFRTMTDVDERAMSEPQETDAELTARF
51 ERDAIPLLDQLYGGALRMTRNPADAEDLLQETMVKAYAGFRSFREGTNLK
101 AWLYRILTNTYINSYRKKQRQPSEYPTDEITDWQLASNAEHSSTGLRSAE
151 VEALEALPDTEIKAALQALPEEFRMAVYYADVEGFPYKEIAEIMDTPIGT
201 VMSRLHRGRKQLRDLLADVARDRGFIRGEQLGAPEGVSS

>ECFp178462 ECF12 ECF12s1 Mycobacterium sp. UNC267MFSha1.1M11

1 MSTACLERPVYLLEPFGRAATEGMGPVTMTDIDEAPAPTEETDAELTARF
51 ERDAIPLLDQLYGGALRMTRNPADAEDLVQETMVKAYAGFRSFREGTNLK
101 AWLYRILTNTYINNYRKKQRQPAEYPTDEITDWQLAANAEHSSTGLRSAE
151 VEALEALPDSEIKDALQALPEEFRMAVYYADVEGFPYKEIAEIMDTPIGT
201 VMSRLHRGRKQLRDLLADVARERGFLRGERLATEEVSS

>ECFp30495 ECF12 ECF12s1 Mycobacteriaceae

1 MPTACLERPVELPDLLRGAATEGTVSTTMTDIDGLGSAVTEHESGGQAHE
51 SDAELTARFERDAIPLLDQLYGGALRMTRNPADAEDLVQETMVKAYSAFH
101 SFRAGTNLKAWLYRIMTNTYINSYRKKQRQPAEYPTDEITDWQLAANAEH
151 SSTGLRSAEVEALEALPDTEIKAALQALPEEFRMAVYYADVEGFPYKEIA
201 EIMDTPIGTVMSRLHRGRKQLRELLSGVARDRGFLRGESLDTQEVS

Name Aliases LCA Taxa Group Subgroup
ECFp30659
  • RNA polymerase subunit sigma
  • ASE48_26335
  • ... more
Mycobacterium sp. Root265 ECF12 ECF12s1

>ECFp30659 ECF12 ECF12s1 Mycobacterium sp. Root265

1 MPTACLDRPVFTLELFGDAATEGTVSPAMTDIDEAARAAETDAELTARFE
51 RDAIPLLDQLYGGALRMTRNPADAEDLLQETMVKAYAGFRSFRAGTNLKA
101 WLYRILTNTYINSYRKKQRQPAEYPTEEITDWQLAANAEHSSTGLRSAEV
151 EALEALPDTEIKAALQALPEEFRMAVYYADVEGFPYKEIAEIMDTPIGTV
201 MSRLHRGRKQLRELLADVARDRGFIRDPQLGAPEEVSS

>ECFp30687 ECF12 ECF12s1 Mycobacterium sp. IS-1742

1 MPTACLQRPVDLPGLFDGAATEGTVSTTMTDIDASAADRQETDAELTARF
51 ERDAIPLLDQLYGGALRMTRNPADAEDLLQETMVKAYSGFRSFREGTNLK
101 AWLYRILTNTYINSYRKKQRQPSEYPTEEITDWQLAANAEHSSTGLRSAE
151 VEALEALPDTEIKAALQALPEDFRMAVYYADVEGFPYKEIAEIMDTPIGT
201 VMSRLHRGRKQLRELLADVARDRGFIRGTQAPEEVSS

>ECFp31158 ECF12 ECF12s1 Mycobacterium sp. YC-RL4

1 MTDIDEAAPAAETDAELTARFERDAIPLLDQLYGGALRMTRNPADAEDLL
51 QETMVKAYAGFRSFRAGTNLKAWLYRILTNTYINSYRKKQRQPAEYPTEE
101 ITDWQLAANAEHSSTGLRSAEVEALEALPDTEIKAALQALPEEFRMAVYY
151 ADVEGFPYKEIAEIMDTPIGTVMSRLHRGRKQLRELLADVARDRGFIRNP
201 QFGAPEEVSS

>ECFp31218 ECF12 ECF12s1 Mycobacterium sp. 852013-50091_SCH5140682

1 MPTVCLERPTDIGQFGGAATEGTVFRTMTDVDERAMSEPQETDAELTARF
51 ERDAIPLLDQLYGGALRMTRNPADAEDLLQETMVKAYAGFRSFREGTNLK
101 AWLYRILTNTYINSYRKKQRQPSEYPTDEITDWQLASNAEHSSTGLRSAE
151 VEALEALPDTEIKAALQALPEEFRMAVYYADVEGFPYKEIAEIMDTPIGT
201 VMSRLHRGRKQLRDLLADVARDRGFIRGEQIGAPEGVSS

>ECFp31399 ECF12 ECF12s1 Mycobacterium sp. GA-2829

1 MPLACLERPVDLPGLFDGAATEGTVSTTMTDIDGSAVEREESDAELTARF
51 ERDAIPLLDQLYGGALRMTRNPADAEDLLQETMVKAYAGFRSFREGTNLK
101 AWLYRILTNTYINSYRKKQRQPSEYPTEEITDWQLAANAEHSSTGLRSAE
151 VEALETLPDTEIKAALQALPEEFRMAVYYADVEGFPYKEIAEIMDTPIGT
201 VMSRLHRGRKQLRELLADVARDRGFIRGAQAPEEVSS

>ECFp31460 ECF12 ECF12s1 Mycolicibacterium canariasense

1 MSTACLERPVYSLESFGRAEREGMGPVTMTDIDEAAPAPTEETDAELTAR
51 FERDAIPLLDQLYGGALRMTRNPADAEDLVQETMVKAYAGFRSFREGTNL
101 KAWLYRILTNTYINNYRKKQRQPSEYPTDEITDWQLASNAEHSSTGLRSA
151 EVEALEALPDSEIKDALQALPEEFRMAVYYADVEGFPYKEIAEIMETPIG
201 TVMSRLHRGRKQLRDLLADVARERGFMRGEQLASEEVSS

Name Aliases LCA Taxa Group Subgroup
ECFp31740
  • RNA polymerase sigma factor RpoE
  • B133_RS0112080
Mycobacterium sp. 155 ECF12 ECF12s1

>ECFp31740 ECF12 ECF12s1 Mycobacterium sp. 155

1 MPTVCLERPVHIGEFGGAATEGTVFCTMTDVDERAMSEPQETDAELTARF
51 ERDAIPLLDQLYGGALRMTRNPADAEDLLQETMVKAYAGFRSFREGTNLK
101 AWLYRILTNTYINSYRKKQRQPSEYPTDEITDWQLAANAEHSSTGLRSAE
151 VEALEALPDTEIKAALQALPEEFRMAVYYADVEGFPYKEIAEIMDTPIGT
201 VMSRLHRGRKQLRDLLADVARDRGFIRDQQLSAPEGVSS

Name Aliases LCA Taxa Group Subgroup
ECFp31788
  • RNA polymerase sigma factor RpoE
  • N536_RS0120910
Mycobacterium sp. URHB0044 ECF12 ECF12s1

>ECFp31788 ECF12 ECF12s1 Mycobacterium sp. URHB0044

1 MTDVDGSIPAAPEETDAELTARFERDAIPLLDQLYGGALRMTRNPADAED
51 LLQETMVKAYAGFRSFREGTNLKAWLYRILTNTYINSYRKKQRQPAEYPT
101 EEITDWQLAANAEHSSTGLRSAEVEAMEALPDTEIKAALQALPEDFRMAV
151 YYADVEGFPYKEIAEIMDTPIGTVMSRLHRGRKQLRELLADVARDRGFLR
201 GQQLDTPEGVTS

>ECFp30718 ECF12 ECF12s1 Branchiibius sp. NY16-3462-2

1 MTHTDQQSAPAPQEELPDEVVHDPAGLDVAAETPAERIERFERDAMPYLD
51 QLYSAALRTTRNPTDAEDLVQETFAKAFAAFHQYKPGTNLKAWLYRILTN
101 TYINTYRKKQREPQQSDAAEVEDYQLHRAASHSSSGLRSAETEALDHLPD
151 SDVKAALQQVPEDFRLAVYLADVEGFSYKEIAEIMDTPIGTVMSRLHRGR
201 RQLRELLEDYARERGFVRDEEASS

Name Aliases LCA Taxa Group Subgroup
ECFp31970
  • RNA polymerase sigma 70
  • DNA-directed RNA polymerase sigma-70 factor
  • ... more
Dermacoccus nishinomiyaensis ECF12 ECF12s1

>ECFp31970 ECF12 ECF12s1 Dermacoccus nishinomiyaensis

1 MVPVEPSALSLTTGFGGAGTRASRVAPHPALGLSAMTDNTTVDALGAPQP
51 DGGAAPRSVTDSKDFDPSTETPAERAARFERDAMPYLDQLYSAALRTTRN
101 PSDAEDLVQETFAKAFAAFHQYKPGTNLKAWLYRIQTNTYINSYRKKQRQ
151 PLESDAAEVEDYQLARAEAHSSTGLKSAENEALDHLPDSDIKRALQALPE
201 DFRLAVYYADVEGFPYKEIAKIMDTPIGTVMSRLHRGRKLLREQLEDYAR
251 ERGFLKGEADTAKGAKK

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more