ECF proteins of ECF subgroup ECF12s1

Displaying ECF 2181 - 2200 of 2311 in total
Name Aliases LCA Taxa Group Subgroup
ECFp30829
  • RNA polymerase sigma24 factor
  • FRAAL_RS26180
Frankia ECF12 ECF12s1

>ECFp30829 ECF12 ECF12s1 Frankia

1 MILVDETTEERGARFERDALPYLDQLYAAALRMTRNPADAEDLVQETFVK
51 AFAAFHQFQEGTNLKAWLYRILTNTFINTYRKRQRQPLQSPTEQVEDWQL
101 AEAESHTSSGLKSAETEALEHLPDSDIKDALQALPEDFRMAVYLADVEGF
151 AYKEIAEIMGTPIGTVMSRLHRGRRGLRKSLEQYAAGRGLVGAGSADGEG
201 GAS

Name Aliases LCA Taxa Group Subgroup
ECFp675
  • RNA polymerase, sigma subunit, ECF family
  • Francci3_3768
Frankia ECF12 ECF12s1

>ECFp675 ECF12 ECF12s1 Frankia

1 MTPGSSTGRRRSAQARTAAGRPLPSVAPMRAPALAGVSSALEGRSRVARS
51 GVVDAGWAAGEHDGEEVILVDETTEERGARFEQDALPYLDQLYAAALRMT
101 RNPADAEDLVQETFVKAFAAFHQFQAGTNLKAWLYRILTNTFINTYRKRQ
151 RQPLQSPTEQVEDWQLAEAGSHTSSGLKSAETEALEHLPDSDIKDALQAL
201 PEDFRMAVYLADVEGFAYKEIAEIMGTPIGTVMSRLHRGRRGLRKSLEKY
251 ALDRGLVAAGSADGEGGAS

Name Aliases LCA Taxa Group Subgroup
ECFp29910
  • RNA polymerase
  • GOSPT_RS05115
Gordonia ECF12 ECF12s1

>ECFp29910 ECF12 ECF12s1 Gordonia

1 MLERPRQPRPGELREGAGSVSLIDITGAPAQTLTGLGGIGVISEGNYVAS
51 PESPDSDGGADRTSDTASQASKTEAPETEASAIDDLTAAAGSAAPRRADP
101 SETDADLTERFERDALPLLDQMYGAALRMTRNPADAEDLVQETYVKAFSA
151 FASFREGTNLKAWLYRILTNTYINGYRKKQRQPAQYPTDEITDWQLAANA
201 EHTSTGLRSAEIEALDALPDDEIKAALQALPEDFRMAVYYADVEGLPYKE
251 IAEIMDTPIGTVMSRLHRGRRQLRELLTDVARDRGFLRQPASESGVAR

Name Aliases LCA Taxa Group Subgroup
ECFp29911
  • RNA polymerase sigma factor RpoE
  • TU34_RS14510
Williamsia herbipolensis ECF12 ECF12s1

>ECFp29911 ECF12 ECF12s1 Williamsia herbipolensis

1 MAPRTSRYGADRGGTLVTESDPSVVADGDSTPAETTEERGARFERDALPL
51 LDQMYGAALRMTRNPADAEDLVQETYVKAFSAFHSFKAGTNLKAWLYRIL
101 TNTYINGYRKRQRQPAQYPTDEITDWQLAATAEHTSTGLRSAEIEALDAL
151 PDDDIKSALQALPEDFRMAVYYADVEGLPYKEIAQIMDTPIGTVMSRLHR
201 GRKQLRELLADVALERGFRRADPVGTDAAKEATR

>ECFp30079 ECF12 ECF12s1 Gordonia otitidis NBRC 100426

1 MASPESPDSAGGADRTSDTVPGESTPVQSTTAESTTEESVTQESASTAAG
51 SAAPRRADPSETDADLTERFERDALPLLDQMYGAALRMTRNPADAEDLVQ
101 ETYVKAFSAFASFREGTNLKAWLYRILTNTYINGYRKKQRQPAQYPTDEI
151 TDWQLAANAEHTSTGLRSAEIEALDALPDDEIKAALQALPEDFRMAVYYA
201 DVEGLPYKEIAEIMDTPIGTVMSRLHRGRRQLRELLTDVARDRGFIREPA
251 SKSGVAR

Name Aliases LCA Taxa Group Subgroup
ECFp30328
  • sigH
  • RNA polymerase ECF-type sigma factor SigH
  • ... more
Gordonia sputi NBRC 100414 ECF12 ECF12s1

>ECFp30328 ECF12 ECF12s1 Gordonia sputi NBRC 100414

1 MIDITGAPAQTLTGLGGIGVISEGNYVASPESPDSDGGADRTSDTASQAS
51 KTEAPETEASAIDDLTAAAGSAAPRRADPSETDADLTERFERDALPLLDQ
101 MYGAALRMTRNPADAEDLVQETYVKAFSAFASFREGTNLKAWLYRILTNT
151 YINGYRKKQRQPAQYPTDEITDWQLAANAEHTSTGLRSAEIEALDALPDD
201 EIKAALQALPEDFRMAVYYADVEGLPYKEIAEIMDTPIGTVMSRLHRGRR
251 QLRELLTDVARDRGFLRQPASESGVAR

Name Aliases LCA Taxa Group Subgroup
ECFp30361
  • hypothetical protein
  • GD1_RS13390
Gordonia ECF12 ECF12s1

>ECFp30361 ECF12 ECF12s1 Gordonia

1 MEGDQAEAGHGSAAPRRADPDETAAELTERFERDALPLLDQMYGAALRMT
51 RNPADAEDLVQETYVKAFSAFASFREGTNLKAWLYRILTNTYINGYRKKQ
101 RQPAQYPTDEITDWQLAATAEHTSTGLRSAEIEALDALPDDEIKDALQAL
151 PEDFRMAVYYADVEGLPYKEIAEIMDTPIGTVMSRLHRGRRQLRGLLADV
201 ARERGFNRSATAKTAKSEVSR

>ECFp30403 ECF12 ECF12s1 Gordonia sp. 852002-10350_SCH5691597

1 MLERPRQPRPGELREGAGSVSLIDITGAPAQTLTGLGGIGVISEGNYVAS
51 PESPDSDGGADRTSDTASQASNPETSTTDDSTAAAGSAPRRADPSETDAD
101 LTERFERDALPLLDQMYGAALRMTRNPADAEDLVQETYVKAFSAFASFRE
151 GTNLKAWLYRILTNTYINGYRKKQRQPAQYPTDEITDWQLAANAEHTSTG
201 LRSAEIEALDALPDDEIKAALQALPEDFRMAVYYADVEGLPYKEIAEIMD
251 TPIGTVMSRLHRGRRQLRELLTDVARDRGFLREPASESGVAR

>ECFp30545 ECF12 ECF12s1 Gordonia polyisoprenivorans HW436

1 MSADMLLDRRRSSEPRTPMADPGSVDLIDIIGPPATVSTGVTTEGIAVTE
51 PDSDGRESSPEAGPEASSPSEGSSPTTGASDGPGSAAPRRADPGESAQDL
101 TERFERDALPLLDQMYGAALRMTRNPADAEDLVQETYVKAFSAFASFREG
151 TNLKAWLYRILTNTYINGYRKKQRQPAQYPTDEITDWQLAANAEHTSTGL
201 RSAEIEALDALPDDEIKAALQALPEDFRMAVYYADVEGLPYKEIAEIMDT
251 PIGTVMSRLHRGRRQLRELLADVARERGFNRSATTSEVAR

Name Aliases LCA Taxa Group Subgroup
ECFp31375
  • sigH
  • RNA polymerase ECF-type sigma factor SigH
  • ... more
Gordonia amarae NBRC 15530 ECF12 ECF12s1

>ECFp31375 ECF12 ECF12s1 Gordonia amarae NBRC 15530

1 MSLAHADSGKVEAVSVSPNLLTRAYGDVSVAPDAPAGQVPSVSLSDSSGR
51 SGTLRGHIEFRQVLTAPQTPVPPVDIEGIAVADSDSGATHSSPEEVDGHD
101 NVDSAPRRADPNESEADLTARFERDALPLLDQMYGAALRMTRNPADAEDL
151 VQETYIKAYTAFASFRDGTNLKAWLYRILTNTYINSYRKKQRQPAQYPTD
201 EITDWQLAATAEHTSSGLRSAEIEALDALPDDEIKQALQALPEDFRMAVY
251 YADVEGLPYKEIAEIMDTPIGTVMSRLHRGRRQLRELLAEVARERGFNRS
301 PKGSDGGKKARKSGGKKSEASGSPADPDPEKTTDPEKKTARTAQKSEVSR

>ECFp31589 ECF12 ECF12s1 Skermania piniformis NBRC 15059

1 MAAPDDGSPGRPNTDLVSRFERDALPLLDQLYGAALRMTRNPADAEDLVQ
51 ETYVKAFSAFASFKEGTNLRAWLYRILTNTYINSYRKKQRQPAQYPTDEI
101 TDWQLAATAEHSSTGLRSAEVEALDALPDDEIKAALQQLPEDFRMAVYYA
151 DVEGFPYKEIAEIMGTPIGTVMSRLHRGRRQLRELLADVARERGFVRQAP
201 AGDAEEQSEVAR

Name Aliases LCA Taxa Group Subgroup
ECFp31836
  • RNA polymerase sigma factor RpoE
  • F600_RS0124290
Smaragdicoccus niigatensis DSM 44881 = NBRC 103563 ECF12 ECF12s1

>ECFp31836 ECF12 ECF12s1 Smaragdicoccus niigatensis DSM 44881 = NBRC 103563

1 MTSGAQPAKQPEDAVDDSGRPSKSASADLATRFETEALPLLDQLYGAALR
51 MTRNPADAEDLVQETYAKAYSAFASFTEGTNLRAWLYRILTNTYINTYRK
101 KQRQPAQYPTDEITDWQLAAAAEHTSQGLRSAEVEALDALPDEEIKAALQ
151 ALPEEFRMAVYYADVEGFPYKEIAEIMGTPIGTVMSRLHRGRKQLRELLA
201 DVARERGFNTGRSEQGVTR

Name Aliases LCA Taxa Group Subgroup
ECFp31947
  • rpoE
  • RNA polymerase
  • ... more
Gordonia polyisoprenivorans VH2 ECF12 ECF12s1

>ECFp31947 ECF12 ECF12s1 Gordonia polyisoprenivorans VH2

1 MSADMLLDRRRSSEPRTPVADPGSVDLIDIIGPPATVSTGVTTEGIAVTE
51 PDSDGRESSPEAGPEASSPSEGSSPTTGASDGPGSAAPRRADPGESAQDL
101 TERFERDALPLLDQMYGAALRMTRNPADAEDLVQETYVKAFSAFASFREG
151 TNLKAWLYRILTNTYINGYRKKQRQPAQYPTDEITDWQLAANAEHTSTGL
201 RSAEIEALDALPDDEIKAALQALPEDFRMAVYYADVEGLPYKEIAEIMDT
251 PIGTVMSRLHRGRRQLRELLADVARERGFNRSATTSEVAR

>ECFp30590 ECF12 ECF12s1 Nocardia speluncae NBRC 108251

1 MATGTGADERPAEQPETGAELDRRFERDALPMLDQLYGAALRMTRNPADA
51 EDLVQETYVKAYAGFKSFKEGTNLRAWLYRILTNTYINSYRKKQRQPAQY
101 PTEEITDWQLAATAEHSSTGLRSAEVEALDALPDDDIKAALIQLPEEFRM
151 AVYYADVEGFPYKEIADIMGTPIGTVMSRLHRGRKQLKGLLGDVARERGF
201 NRSAESTEVRQEVKQ

Name Aliases LCA Taxa Group Subgroup
ECFp30598
  • RNA polymerase
  • ON32_RS16050
Nocardia paucivorans NBRC 100373 ECF12 ECF12s1

>ECFp30598 ECF12 ECF12s1 Nocardia paucivorans NBRC 100373

1 MAEVDDTDVDTAEADTRDAETEAELAERFERDALPLLDQLYGAALRMTRN
51 PADAEDLVQETYVKAFSGFKSFKEGTNLRAWLYRILTNTYINSYRKKQRQ
101 PAQYPTDEITDWQLAATAEHSSVGLRSAEVEALDALPDDTIKAALQELPE
151 EFRMAVYYADVEGFPYKEIADIMGTPIGTVMSRLHRGRKQLKGLLADVAR
201 ERGFNRTGAEQATPAGSVRQEVKQ

Name Aliases LCA Taxa Group Subgroup
ECFp31145
  • RNA polymerase sigma factor RpoE
  • rpoE
  • ... more
Nocardia cyriacigeorgica GUH-2 ECF12 ECF12s1

>ECFp31145 ECF12 ECF12s1 Nocardia cyriacigeorgica GUH-2

1 MTSDEDVAEDPTALAQRFERDALPLLDQLYGAALRMTRNPADAEDLVQET
51 YVKAYQGFKSFKEGTNLRAWLYRILTNTYINSYRKKQRQPAQYPTDEITD
101 WQLAATAEHTSTGLRSAEVEALDALPDDDIKAALQELPEEFRMAVYYADV
151 EGFPYKEIADIMGTPIGTVMSRLHRGRKQLKGLLADVARERGFNRAGGTS
201 DDTSASTADTVRQEVKQ

>ECFp31257 ECF12 ECF12s1 Nocardia flavorosea NBRC 108225

1 MATGTGADERPAEQPETGAELDRRFERDALPMLDQLYGAALRMTRNPADA
51 EDLVQETYVKAYAGFKSFKEGTNLRAWLYRILTNTYINSYRKKQRQPAQY
101 PTDEITDWQLAATAEHSSTGLRSAEVEALDALPDDDIKAALIQLPEEFRM
151 AVYYADVEGFPYKEIADIMGTPIGTVMSRLHRGRKQLKGLLGDVARERGF
201 NRAAESTEVRQEVKQ

>ECFp31926 ECF12 ECF12s1 Nocardia pseudobrasiliensis

1 MDDDFADDEPGARSNSSDTELAERFERDALPLLDQLYGAALRMTRNPADA
51 EDLVQETFAKAYQGFRSFREGTNLRAWLYRILTNTYINSYRKKQRQPAQY
101 PTDEITDWQLASTAEHTSTGLRSAEMEALEALPDDDIKAALQSLPEEFRM
151 AVYYADVEGFPYKEIADIMGTPIGTVMSRLHRGRKQLKTLLADVARERGF
201 DRNRAGEGTRQEVTQ

>ECFp30894 ECF12 ECF12s1 Streptomyces auratus AGR0001

1 MGPVTGTDAGTDGTAEERAQESAAERNARFERDALTFLDQMYSAALRMTR
51 NPADAEDLVQEMYAKAYASFHQFREGTNLKAWLYRILTNTFINSYRKKQR
101 EPQRSAAEEIEDWQLARAESHMSTGLRSAESQALDHLPDSDVKAALQAIP
151 EEFRIAVYLADVEGFAYKEIADIMGTPIGTVMSRLHRGRRQLRGMLEDYA
201 RERGLVPAGAGAADPQAARTTESHDRKGSGS

>ECFp31147 ECF12 ECF12s1 Streptomyces decoyicus

1 MGPVTGTDAGTDGTAEEKAQESAAERNARFERDALTFLDQMYSAALRMTR
51 NPADAEDLVQETYAKAYASFHQFREGTNLKAWLYRILTNTFINSYRKKQR
101 EPQRSAAEEIEDWQLARAESHMSTGLRSAESQALDHLPDSDVKAALQEIP
151 EEFRIAVYLADVEGFAYKEIADIMGTPIGTVMSRLHRGRRQLRGMLEDYA
201 RERGLVPAGAAAADPQSARTSESHDRKGSGS

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more