ECF proteins of ECF subgroup ECF12s1

Displaying ECF 2161 - 2180 of 2311 in total

>ECFp30853 ECF12 ECF12s1 Gordonia rubripertincta NBRC 101908

1 MSTAAVLEPPVLVEATHLLSGPGSVSLTGNVPVTPLIEGIVVAEAESADT
51 EAAGPGSTATGSAADASAEKGAPRRADPSESPEELTERFERDALPLLDQM
101 YGAALRMTRNPADAEDLVQETYIKAFTAFASFREGTNLKAWLYRILTNTY
151 INGYRKKQRQPAQYPTDEITDWQLASTAEHTSQGLRSAEIEALDALPDDE
201 IKAALQELPEDFRMAVYYADVEGLPYKEIAEIMDTPIGTVMSRLHRGRRQ
251 LRELLADVARERGFHRSATAKGAEVAR

Name Aliases LCA Taxa Group Subgroup
ECFp30973
  • RNA polymerase sigma factor RpoE
  • GOAMI_RS15120
Gordonia amicalis ECF12 ECF12s1

>ECFp30973 ECF12 ECF12s1 Gordonia amicalis

1 MAEAESADTEKGSAEKGAPRRTDPSESPAELTERFERDALPLLDQMYGAA
51 LRMTRNPADAEDLVQETYIKAFTAFASFREGTNLKAWLYRILTNTYINGY
101 RKKQRQPAQYPTDEITDWQLASTAEHTSQGLRSAEIEALDALPDDDIKAA
151 LQELPEDFRMAVYYADVEGLPYKEIAEIMDTPIGTVMSRLHRGRRQLREL
201 LADVARERGFNRSASAKGAEVAR

Name Aliases LCA Taxa Group Subgroup
ECFp31016
Gordonia sp. HS-NH1 ECF12 ECF12s1

>ECFp31016 ECF12 ECF12s1 Gordonia sp. HS-NH1

1 MSTAAVMELPQRTEPRSLSVGDGSVSLIDNISVMPPIEGIVVSDTEASDT
51 ESSGPGSSGPAQSATGRSGTAKAPRRADPSESPEQLTERFERDALPLLDQ
101 MYGAALRMTRNPADAEDLVQETYIKAFTAFASFREGTNLKAWLYRILTNT
151 YINGYRKKQRQPAQYPTDEITDWQIAATAEHTSQGLRSAEIEALDALPDD
201 EIKAALQELPEDFRMAVYYADVEGLPYKEIAEIMDTPIGTVMSRLHRGRR
251 QLRELLADVARERGFNRSARAAADAEVAR

Name Aliases LCA Taxa Group Subgroup
ECFp31055
Gordonia sp. KTR9 ECF12 ECF12s1

>ECFp31055 ECF12 ECF12s1 Gordonia sp. KTR9

1 MSTAAVMELPQRTEPRSLSVGDGSVSLIDNISVMPPIEGIVVSDTEASDT
51 ESSGPGSSGPAQSATGRSGTAKAPRRADPSESPEQLTERFERDALPLLDQ
101 MYGAALRMTRNPADAEDLVQETYIKAFTAFASFREGTNLKAWLYRILTNT
151 YINGYRKKQRQPAQYPTDEITDWQIAATAEHTSQGLRSAEIEALDALPDD
201 EIKAALQELPEDFRMAVYYADVEGLPYKEIAEIMDTPIGTVMSRLHRGRR
251 QLRELLADVARERGFNRSARATDAEVAR

Name Aliases LCA Taxa Group Subgroup
ECFp31345
  • RNA polymerase sigma factor RpoE
  • RNA polymerase subunit sigma
  • ... more
Gordonia ECF12 ECF12s1

>ECFp31345 ECF12 ECF12s1 Gordonia

1 MLCWDCSDNGRTHTDTKEVGRQMSTAAVMELPQRTEPRSLSVGDGSVSLI
51 DNISVMPPIEGIVVSDTEASDTESSETGRTGTAKAPRRADPNESPEQLTE
101 RFERDALPLLDQMYGAALRMTRNPADAEDLVQETYIKAFTAFASFREGTN
151 LKAWLYRILTNTYINGYRKKQRQPAQYPTDEITDWQIAATAEHTSQGLRS
201 AEIEALDALPDDEIKAALQELPEDFRMAVYYADVEGLPYKEIAEIMDTPI
251 GTVMSRLHRGRRQLRELLADVARERGFNRSARVTDAEVAR

>ECFp31451 ECF12 ECF12s1 Gordonia namibiensis NBRC 108229

1 MSAEKGAPRRADPSESPEELTERFERDALPLLDQMYGAALRMTRNPADAE
51 DLVQETYIKAFTAFASFREGTNLKAWLYRILTNTYINGYRKKQRQPAQYP
101 TDEITDWQLASTAEHTSQGLRSAEIEALDALPDDEIKAALQELPEDFRMA
151 VYYADVEGLPYKEIAEIMDTPIGTVMSRLHRGRRQLRELLADVARERGFH
201 RSATAKGAEVAR

Name Aliases LCA Taxa Group Subgroup
ECFp31519
  • sigH
  • RNA polymerase ECF-type sigma factor SigH
  • ... more
Gordonia amicalis NBRC 100051 = JCM 11271 ECF12 ECF12s1

>ECFp31519 ECF12 ECF12s1 Gordonia amicalis NBRC 100051 = JCM 11271

1 MSSTAVLEPPELVEARPLLPGPRSVSLTGNVPVTPLIEGIVVAEAESADT
51 EKGSAEKGAPRRTDPSESPAELTERFERDALPLLDQMYGAALRMTRNPAD
101 AEDLVQETYIKAFTAFASFREGTNLKAWLYRILTNTYINGYRKKQRQPAQ
151 YPTDEITDWQLASTAEHTSQGLRSAEIEALDALPDDDIKAALQELPEDFR
201 MAVYYADVEGLPYKEIAEIMDTPIGTVMSRLHRGRRQLRELLADVARERG
251 FNRSASAKGAEVAR

>ECFp31734 ECF12 ECF12s1 Corynebacteriales

1 MSTAAVMELPQRVEPRPLSVGDGSVSLIDNISVMPPIEGIVVSDTEASDT
51 ESPDSGRTGSAKAPRRADPNESPEQLTERFERDALPLLDQMYGAALRMTR
101 NPADAEDLVQETYIKAFTAFASFREGTNLKAWLYRILTNTYINGYRKKQR
151 QPAQYPTDEITDWQIAATAEHTSQGLRSAEIEALDALPDDEIKAALQELP
201 EDFRMAVYYADVEGLPYKEIAEIMDTPIGTVMSRLHRGRRQLRELLADVA
251 RERGFNRSARAAADAEVAR

Name Aliases LCA Taxa Group Subgroup
ECFp140250
Friedmanniella flava ECF12 ECF12s1

>ECFp140250 ECF12 ECF12s1 Friedmanniella flava

1 MPMFVTPLPRDAARAEAPPVLSYVMSIPATPASAPSSSELDSQADALLAT
51 VEQPPVDLATETQAERDARFEHDALQYLDQLYAAALRMTRNPSDAEDVVQ
101 ETFAKAYSSFHQFTPGTNLKAWLYRILTNTYINTYRKKQRQPQLSDGENV
151 EDWQIARAASHTSSGLKSAETEALENLPDSDVKDALGQLSPDFRLAVFLA
201 DVEGFAYKEIAEIMGTPIGTVMSRLNRGRTQLRRLLSDYARERGMRVKED
251 TRA

Name Aliases LCA Taxa Group Subgroup
ECFp178471
Microlunatus soli ECF12 ECF12s1

>ECFp178471 ECF12 ECF12s1 Microlunatus soli

1 MTIPTGSPTSAPSQAEVLDDDEVRAPAETEAERRQRFEADALEFIDQLYA
51 AGMRMTRNPADAEDLVQETYTKAYSSFHQFRPGTNLKAWLYRILTNTYIN
101 NYRKKQRQPQVSDGSDVEDWQLARAESHTSTGLKSAEMVALENLPDSDVK
151 DALQELAPDFRLAVYLADVEGFAYKEIAEIMGTPIGTVMSRLNRGRGQLR
201 HHLEDYARDRGLLRETKQQEARA

Name Aliases LCA Taxa Group Subgroup
ECFp178874
Raineyella antarctica ECF12 ECF12s1

>ECFp178874 ECF12 ECF12s1 Raineyella antarctica

1 MRLVSLLMTETHSDDNADTASWGDAAEGALDVRPSDAVAVDLESETDDER
51 AARFEQDAMPYLDQLYGAALRMTRNRADAEDVVQEAYAKAFASFRQFTPG
101 TNLKAWLYRILTNTYINSYRKQQRRPQISDGEDIEDWQIAQAAGHDPVGL
151 KSAETEALEQIPDGEVSDALAQLSPERRMAVYLADVEGFSYKEIAEIMGT
201 PIGTVMSRLNRGRKQLRDLLADVAQERGLGRQREGEA

>ECFp31678 ECF12 ECF12s1 Mycobacterium sp. 1465703.0

1 MADSENGRDDATGPEIGEPAAHEETDAELTARFERDAIPLLDQLYGGALR
51 MTRNPADAEDLLQETMVKAYAGFRSFRAGTNLKAWLYRILTNTYINSYRK
101 KQRQPAEYPTEEITDWQLASNAEHSSTGLRSAEVEALEALPDSEIKDALA
151 ALPEEFRMAVYYADVEGFPYKEIAEIMDTPIGTVMSRLHRGRRQLRGLLA
201 DVAKDRGFNRGEQTHEEVSS

>ECFp30504 ECF12 ECF12s1 Mycobacterium

1 MADSEDGRDGATGPEIPGPAAHDETDAELTARFERDAIPLLDQLYGGALR
51 MTRNPADAEDLLQETMVKAYAGFRSFRAGTNLKAWLYRILTNTYINSYRK
101 KQRQPAEYPTEEITDWQLASNAEHSSTGLRSAEVEALEALPDSEIKEALA
151 ALPEEFRMAVYYADVEGFPYKEIAEIMDTPIGTVMSRLHRGRRQLRGLLA
201 DVAKERGFNRGQQTHEEVSS

>ECFp30934 ECF12 ECF12s1 Mycobacterium sp. E2479

1 MADALSGSDGATGPEISGPAAHEETDAELTARFERDAIPLLDQLYGGALR
51 MTRNPADAEDLLQETMVKAYAGFRSFRAGTNLKAWLYRILTNTYINSYRK
101 KQRQPAEYPTEEITDWQLASNAEHSSTGLRSAEVEALEALPDSEIKEALA
151 ALPEEFRMAVYYADVEGFPYKEIAEIMDTPIGTVMSRLHRGRRQLRALLA
201 DVAKERGFNRGQQTHEEVSS

>ECFp31954 ECF12 ECF12s1 Mycobacterium sp. 1165178.9

1 MADSEDGRDGAIGPEVSEPAAHETDAELTARFERDAIPLLDQLYGGALRM
51 TRNPADAEDLLQETMVKAYAGFRSFRAGTNLKAWLYRILTNTYINSYRKK
101 QRQPAEYPTEEITDWQLASNAEHSSTGLRSAEVEALEALPDSEIKDALAA
151 LPEEFRMAVYYADVEGFPYKEIAEIMDTPIGTVMSRLHRGRRQLRGLLAD
201 VAKERGFNRGQQTHEEVSS

Name Aliases LCA Taxa Group Subgroup
ECFp30040
  • RNA polymerase sigma factor RpoE
  • PALO_RS04655
Propionibacteriaceae ECF12 ECF12s1

>ECFp30040 ECF12 ECF12s1 Propionibacteriaceae

1 MTTREFEPRMDRHGDVPGTVDVAKETEAERAERFERDALEYLDQLYGAAL
51 RMTRNPADAEDVVQETYAKAFASFHQFRPGTNLKAWLYRILTNTYINSYR
101 KAQRRPQTSDDQDIEDWQIARAASHDSNGLRSAELEALDGLPDQQILDAL
151 DGLSDEFRQVVLLADVEGFAYKEIAEIMGTPIGTVMSRLNRARKQLRKQL
201 VDVAGARGIGPHAGQIDEEDLGRPELARSAGKEGSR

>ECFp30106 ECF12 ECF12s1 Acidipropionibacterium acidipropionici

1 MTIPSSGAGEAHGRDEAEETDQQRVARFERDAMEYLDQLYGAALRMTRNA
51 ADAEDVVQETYAKAFASFKQFRPGTNLKAWLFRILTNTYINTYRKAQRRP
101 QTSDDENVEDWQIARAASHEATGLRSAEVEALDAMPDTQVVRALDSLSED
151 FREVVTLADIEGFSYKEIAQIMGTPIGTVMSRLNRARKQLRGQLVDVAGA
201 RGIGPKAGKVDEETLGQEVHS

Name Aliases LCA Taxa Group Subgroup
ECFp30430
Frankia sp. QA3 ECF12 ECF12s1

>ECFp30430 ECF12 ECF12s1 Frankia sp. QA3

1 MILVDETTEERGARFERDALPYLDQLYAAALRMTRNPADAEDLVQETFVK
51 AFAAFHQFQEGTNLKAWLYRILTNTFINTYRKRQRQPLQSPTEQVEDWQL
101 AEAESHTSSGLKSAETEALEHLPDSDIKDALQALPEDFRMAVYLADVEGF
151 AYKEIAEIMGTPIGTVMSRLHRGRRGLRKSLEKYAADRGLVGAGSADGEG
201 GAS

Name Aliases LCA Taxa Group Subgroup
ECFp30440
  • RNA polymerase sigma24 factor
  • FRANCCI3_RS19035
Frankia ECF12 ECF12s1

>ECFp30440 ECF12 ECF12s1 Frankia

1 MILVDETTEERGARFEQDALPYLDQLYAAALRMTRNPADAEDLVQETFVK
51 AFAAFHQFQAGTNLKAWLYRILTNTFINTYRKRQRQPLQSPTEQVEDWQL
101 AEAGSHTSSGLKSAETEALEHLPDSDIKDALQALPEDFRMAVYLADVEGF
151 AYKEIAEIMGTPIGTVMSRLHRGRRGLRKSLEKYALDRGLVAAGSADGEG
201 GAS

Name Aliases LCA Taxa Group Subgroup
ECFp30620
  • RNA polymerase sigma24 factor
  • CRYAR_RS34945
Cryptosporangium arvum DSM 44712 ECF12 ECF12s1

>ECFp30620 ECF12 ECF12s1 Cryptosporangium arvum DSM 44712

1 MAERNARFERDALPFLDQLYAAALRMTRNPADAEDLVQEAFVKAYAAFHQ
51 FQEGTNLKAWLYRILTNTFINNYRKRQRQPQQSPTEQIEDWQLAAAESHS
101 SSGLRSAEVEALDRLPDSDVKDALQALPEEFRLAVYLADVEGFSYKEIAD
151 IMGTPIGTVMSRLHRGRRNLRRQLEQYALDRGIVRAAPEGVSS

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more