ECF proteins of ECF subgroup ECF12s1

Displaying ECF 2141 - 2160 of 2311 in total
Name Aliases LCA Taxa Group Subgroup
ECFp140352
Streptomyces alni ECF12 ECF12s1

>ECFp140352 ECF12 ECF12s1 Streptomyces alni

1 MVSAACRPRAEAAQATARPDAAAPYLNWAEWPVKDDGKGASGTPISRGIS
51 SETSVSAFGRAGVSEEVGAVTGTDDSTAENAGASGEAAQESSAERTERFE
101 RDALGFLDQMYSAALRMTRNPADAEDLVQETYAKAYASFHQFREGTNLKA
151 WLYRILTNSFINSYRKKQREPLRSGSEEIEDWQLARAESHMSTGLRSAES
201 QALDHLPDSDVKAALQTIPEEFRIAVYLADVEGFAYKEIADIMGTPIGTV
251 MSRLHRGRRQLRELLEDYARDRGLVPAGAADEKGADS

>ECFp140398 ECF12 ECF12s1 Streptomyces sp. DvalAA-14

1 MVSAACRPSAQGTAQPGVAVPYLEWTQWSNKDDGKAASGVPIPGAISSQT
51 SVSTLGRAGVSEEVGPVTGTDDSTAETAGASGQAARESESERSERFERDA
101 LSFLDQMYSAALRMTRNPADAEDLVQETYAKAYASFHQFREGTNLKAWLY
151 RILTNSFINSYRKKQREPLRSGSEDIEDWQLARAESHMSTGLRSAESQAL
201 DHLPDSDVKSALQAIPEEFRIAVYLADVEGFAYKEIADIMGTPIGTVMSR
251 LHRGRRQLRELLEDYARDRGLVPAGAGDQKGADS

>ECFp178498 ECF12 ECF12s1 Streptomyces cinnamoneus

1 MGPVTGTDTGADDSQKRGPVGGAAGAEGGETVAERNARFERDALTFLDQM
51 YSAALRMTRNAADAEDLVQETYAKAYASFHQFRDGTNLKAWLYRILTNTF
101 INSYRKKQREPLRSASEEIEDWQLARAESHMSTGLRSAESQALDHLPDSD
151 VKEALQAIPEEFRIAVYLADVEGFAYKEIADIMGTPIGTVMSRLHRGRRQ
201 LRGLLEDYARERGLVPAGATAPARNGSDESHNRKGSDS

Name Aliases LCA Taxa Group Subgroup
ECFp178567
  • RNA polymerase sigma factor RpoE
  • H340_RS00325
Streptomyces mobaraensis NBRC 13819 = DSM 40847 ECF12 ECF12s1

>ECFp178567 ECF12 ECF12s1 Streptomyces mobaraensis NBRC 13819 = DSM 40847

1 MGPVVGTDAGTHGEEHPPAQAAESAAERSARFERDALTFLDQMYSAALRM
51 TRNPADAEDLVQETYAKAYASFHQFRDGTNLKAWLYRILTNTFINSYRKK
101 QREPLRSASEEIEDWQLARAESHMSQGLRSAESQALDHLPDSDVKEALQA
151 IPEEFRIAVYLADVEGFAYKEIADIMGTPIGTVMSRLHRGRRQLRGLLED
201 YARERGLVPAGAAAPHGSDASHNGKGSDS

>ECFp178730 ECF12 ECF12s1 Jiangella sp. DSM 45060

1 MVDTAAPVDLTVMADQESDEQRTQRFERDALPFLDQLYSAALRMTRNASD
51 AEDLVQETFAKAYASFHQFKEGTNLKAWLYRILTNTFINTYRKKQREPQQ
101 SATEEIEDWQMARAEAHTSTGLRSAEAEALAHLPDSDVKNALQEIPEEFR
151 IAVYLADVEGFPYKEIADIMGTPIGTVMSRLHRGRRQLRGLLEDYARERG
201 LVPKVTQEVGG

>ECFp178733 ECF12 ECF12s1 Streptomyces guanduensis

1 MGAQVVPATPGQAAAAPYLNWAEWATKDDAKGTSGTSGGRAISSETSVSA
51 SGRASVTKEVGPVTGTDDSTADTARASGQGVEESETERSARFERDAMGYL
101 DQMYSAALRMTRNPADAEDLVQETYAKAYASFHQFREGTNLKAWLYRILT
151 NSFINSYRKKQREPLRSGSEEIEDWQLARAESHMSTGLRSAESQALDHLP
201 DSDVKSALQAIPEEFRIAVYLADVEGFAYKEIADIMGTPIGTVMSRLHRG
251 RRQLRELLEDYARDRGLVPAGAANEKGADS

>ECFp178839 ECF12 ECF12s1 Streptomyces gilvigriseus

1 MEEVVPVTGTEKAEQAAAQAAKTAEAPGGESDEERTARFERDALGYLDQL
51 YSAALRMTRNPSDAEDLVQETYAKAYGSFHQFREGTNLKAWLYRILTNTF
101 INSYRKRQREPQRGGTEEIEDWQLARAESHMSTGLRSAESQALDHLPDSD
151 VKQALQAIPEEFRIAVYLADVEGFAYKEIADIMGTPIGTVMSRLHRGRRQ
201 LRGMLEDYARERGLLRGADADSLAASSAQGSNGAEAKGAES

>ECFp178881 ECF12 ECF12s1 Actinopolymorpha singaporensis

1 MVAACQNRPTPSTQPPPEAVAVWREWTPEDGSSSVGLSSRAMTAAVNAET
51 PEERSARFERDALPFLDQLYNAALRMTRNPADADDLVQETFAKAYSSFHQ
101 FSEGTNLKAWLYRILTNTFINSYRKRQREPQRAATEEIEDWQIARAESHT
151 SAGLKSAEAEALEHLPDSDVKEALQQVPDDFRMAVYLADVEGFSYKEIAD
201 IMGTPIGTVMSRLHRGRRQLRELLQDYARGRGLVPAADAKGGEDA

Name Aliases LCA Taxa Group Subgroup
ECFp30128
  • RNA polymerase sigma factor RpoE
  • AC230_16240
Streptomyces caatingaensis ECF12 ECF12s1

>ECFp30128 ECF12 ECF12s1 Streptomyces caatingaensis

1 MGPVAGTDVGANDEGLPSGRQAESAAERNARFERDALTFLDQMYSAALRM
51 TRNPADAEDLVQETYAKAYASFHQFRDGTNLKAWLYRILTNTFINSYRKK
101 QREPLRSASEEIEDWQLARAESHMSQGLRSAESQALDHLPDSDVKEALQA
151 IPEEFRIAVYLADVEGFAYKEIADIMGTPIGTVMSRLHRGRRQLRGLLED
201 YARERGLVPAGAAAPNGSDASHDRKGSDS

Name Aliases LCA Taxa Group Subgroup
ECFp30218
Jiangella alba ECF12 ECF12s1

>ECFp30218 ECF12 ECF12s1 Jiangella alba

1 MTDQESDEQRTQRFERDALPYLDQLYSAALRMTRNASDAEDLVQETFAKA
51 YASFHQFKEGTNLKAWLYRILTNTFINTYRKKQREPQQSATEEIEDWQMA
101 RAEAHTSTGLRSAEAEALAHLPDSDVKNALQEIPEEFRIAVYLADVEGFP
151 YKEIADIMGTPIGTVMSRLHRGRRQLRGLLEDYARERGLVPKVTQEVGG

Name Aliases LCA Taxa Group Subgroup
ECFp30559
  • hypothetical protein
  • JIAGA_RS0107230
Jiangella gansuensis DSM 44835 ECF12 ECF12s1

>ECFp30559 ECF12 ECF12s1 Jiangella gansuensis DSM 44835

1 MAEQESDEQRTQRFERDALPYLDQLYSAALRMTRNASDAEDLVQETFAKA
51 YASFHQFKEGTNLKAWLYRILTNTFINTYRKRQREPQQSATEEIEDWQMA
101 RAEAHTSTGLRSAEAEALAHLPDSDVKNALQEIPEEFRIAVYLADVEGFP
151 YKEIADIMGTPIGTVMSRLHRGRRQLRGLLEDYARERGLVPKVTQEVGG

Name Aliases LCA Taxa Group Subgroup
ECFp31418
  • RNA polymerase sigma factor RpoE
  • SCATT_RS19285
Streptomyces cattleya NRRL 8057 = DSM 46488 ECF12 ECF12s1

>ECFp31418 ECF12 ECF12s1 Streptomyces cattleya NRRL 8057 = DSM 46488

1 MGPVTGTDDGTTEEQPRPRLDAESPEERSARFERDALTFLDQMYSAALRM
51 TRNPSDAEDLVQETYAKAYGSFHQFREGTNLKAWLYRILTNTFINSYRKK
101 QREPQRSGTEEIEDWQLARAESHMSTGLRSAESQALDHLPDSDVKSALQA
151 IPEEFRIAVYLADVEGFAYKEIADIMGTPIGTVMSRLHRGRRQLRGLLED
201 YARERGLVPAGASAGTGESHDRKGSDQ

>ECFp31475 ECF12 ECF12s1 Streptomyces sp. NRRL F-5123

1 MGPVTGTDDSTAETAGASGQEAAESSTERAQRFERDALGFLDQMYSAALR
51 MTRNPADAEDLVQETYAKAYASFHQFREGTNLKAWLYRILTNSFINSYRK
101 KQREPLRSGSEDIEDWQLARAESHMSTGLRSAESQALDHLPDSDVKAALQ
151 AIPEEFRIAVYLADVEGFAYKEIADIMGTPIGTVMSRLHRGRRQLRELLE
201 DYARDRGLVPAGAGSEKGADS

Name Aliases LCA Taxa Group Subgroup
ECFp31698
Jiangella muralis ECF12 ECF12s1

>ECFp31698 ECF12 ECF12s1 Jiangella muralis

1 MADQESAEQRTQRFERDALPYLDQLYSAALRMTRNASDAEDLVQETFAKA
51 YASFHQFKEGTNLKAWLYRILTNTFINTYRKKQREPQQSATEEIEDWQMA
101 RAEAHTSSGLLSAEAEALAHLPDSDVKNALQEIPEEFRIAVYLADVEGFP
151 YKEIADIMGTPIGTVMSRLHRGRRQLRGLLEDYARERGLVPKVTQEVGG

Name Aliases LCA Taxa Group Subgroup
ECFp31779
  • RNA polymerase subunit sigma
  • ACTRO_RS19850
Actinospica robiniae DSM 44927 ECF12 ECF12s1

>ECFp31779 ECF12 ECF12s1 Actinospica robiniae DSM 44927

1 MVGAGWERRGPGPDTEVGRSVGTDADREHLAPGELEPEPAEAQDEALAAP
51 EGDDESPAERDARFERDAMPFLDALYSAALRMTRNPADAEDLVQETYAKA
101 YASFHQFRPGTNLKAWMYRILTNTFINGYRKKQREPLSAGTDEIEDWQLH
151 RAESHSSTGLRSAEVEALDHLPDSDVKEALQSIGEDFRMAVYLADVEGFP
201 YKEIADIMGTPIGTVMSRLHRGRRQLRELLGDYAQQRGFGPAESSSGSGK
251 DKEAVS

Name Aliases LCA Taxa Group Subgroup
ECFp31828
Gordonia sp. UCD-TK1 ECF12 ECF12s1

>ECFp31828 ECF12 ECF12s1 Gordonia sp. UCD-TK1

1 MSTAAVMELPQRVEPRPLSVGDGSVSLIDNISVMPPIEGIVVSDTEASDT
51 ESPDSGRTGSAKAPRRADPNESPEQLTERFERDALPLLDQMYGAALRMTR
101 NPADAEDLVQETYIKAFTAFASFREGTNLKAWLYRILTNTYINGYRKKQR
151 QPAQYPTDEITDWQIAATAEHTSQGLRSAEIEALDALPDDEIKAALQDLP
201 EDFRMAVYYADVEGLPYKEIAEIMDTPIGTVMSRLHRGRRQLRELLADVA
251 RERGFNRSARAAADAEVAR

Name Aliases LCA Taxa Group Subgroup
ECFp178643
Gordonia westfalica ECF12 ECF12s1

>ECFp178643 ECF12 ECF12s1 Gordonia westfalica

1 MSTTAVLEPPALVEVMPLLPGPGSVSLTGNVPVTPLIEGIVVAEAESADT
51 EKGSAEKSAPRRADPSESPEQLTERFERDALPLLDQMYGAALRMTRNPAD
101 AEDLVQETYIKAFTAFASFREGTNLKAWLYRILTNTYINGYRKKQRQPAQ
151 YPTDEITDWQLAATAEHTSQGLRSAEIEALDALPDDEIKAALQELPEDFR
201 MAVYYADVEGLPYKEIAEIMDTPIGTVMSRLHRGRRQLRELLADVARERG
251 FNRSAGAKGAEVAR

>ECFp29964 ECF12 ECF12s1 Gordonia rubripertincta NBRC 101908

1 MAEAESADTEAAGPGSTATGSAADASAEKGAPRRADPSESPEELTERFER
51 DALPLLDQMYGAALRMTRNPADAEDLVQETYIKAFTAFASFREGTNLKAW
101 LYRILTNTYINGYRKKQRQPAQYPTDEITDWQLASTAEHTSQGLRSAEIE
151 ALDALPDDEIKAALQELPEDFRMAVYYADVEGLPYKEIAEIMDTPIGTVM
201 SRLHRGRRQLRELLADVARERGFHRSATAKGAEVAR

Name Aliases LCA Taxa Group Subgroup
ECFp30149
Gordonia terrae C-6 ECF12 ECF12s1

>ECFp30149 ECF12 ECF12s1 Gordonia terrae C-6

1 MSDTEASDTESSGPAQSATGRSGTAKAPRRADPSESPEQLTERFERDALP
51 LLDQMYGAALRMTRNPADAEDLVQETYIKAFTAFASFREGTNLKAWLYRI
101 LTNTYINGYRKKQRQPAQYPTDEITDWQIAATAEHTSQGLRSAEIEALDA
151 LPDDEIKAALQELPEDFRMAVYYADVEGLPYKEIAEIMDTPIGTVMSRLH
201 RGRRQLRELLADVARERGFNRSARATDAEVAR

Name Aliases LCA Taxa Group Subgroup
ECFp30741
Gordonia terrae C-6 ECF12 ECF12s1

>ECFp30741 ECF12 ECF12s1 Gordonia terrae C-6

1 MSTAAVMELPQRTEPRSLSVGDGSVSLIDNISVMPPIEGIVVSDTEASDT
51 ESSGPAQSATGRSGTAKAPRRADPSESPEQLTERFERDALPLLDQMYGAA
101 LRMTRNPADAEDLVQETYIKAFTAFASFREGTNLKAWLYRILTNTYINGY
151 RKKQRQPAQYPTDEITDWQIAATAEHTSQGLRSAEIEALDALPDDEIKAA
201 LQELPEDFRMAVYYADVEGLPYKEIAEIMDTPIGTVMSRLHRGRRQLREL
251 LADVARERGFNRSARATDAEVAR

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more