ECF proteins of ECF group ECF62

Displaying ECF 1 - 20 of 54 in total
Name Aliases LCA Taxa Group Subgroup
ECFp108454
  • RNA polymerase sigma-H factor
  • RMSM_00858
  • ... more
Rhodopirellula maiorica SM1 ECF62 ECF62s4

>ECFp108454 ECF62 ECF62s4 Rhodopirellula maiorica SM1

1 MGLGAGISSTDYSDVLTGGGRQTAGSGGSILCAMGKGNNSDSPQARRYSI
51 LGCPPHSRSAQWLMNSHSQNLPTRISLLELAQSGKDHPAWEELLDYYRPF
101 IRRILTHLGVPPSDLDDACQLTLMRLWRDLANYQHQPNRARFRTWLSRLI
151 HNTAMDWHRGQRHKDKTISSESSQLEQTLMCESELEQQIEKEWRQHIVQL
201 ALERLKNVFSGDALDVFVRSVEGESAAEISRDLNIREESVYVLKHRVKKR
251 LILESFELRRELEFPDSMP

>ECFp101416 ECF62 ECF62s4 Rhodopirellula sp. SWK7

1 MNSHSQNLPTRISLLELAQSGKDHPAWEELLDYYRPFVRRILTHLGVSGS
51 DLDDACQLALMRLWRDLVNYRHQPNRARFRSWLSRLIHNTAMDWHRHQRR
101 NSKTMSTEVEQIQHSLMCESDLEEQIEKEWRQHIVNLALERLKSVFSGDA
151 LDVFVRSVEGESAAQISRDLNIREESVYVLKHRVKKRLILEAFELRRELE
201 FPDSTP

Name Aliases LCA Taxa Group Subgroup
ECFp102237
  • RNA polymerase sigma-H factor
  • RSSM_01129
Rhodopirellula sallentina SM41 ECF62 ECF62s4

>ECFp102237 ECF62 ECF62s4 Rhodopirellula sallentina SM41

1 MTSQSQNLPTRISLLELAQSGQDHPAWEELLEYYRPFIRRVLVHLGISQA
51 DLDDACQLTLMRLWKDLANYQHQPNRARFRTWLSRLVHNTAMDWHRRHKR
101 SQKSFSTDATHLEQTLMCEPDMEQQIEKEWRQHIVNLALERLRSVFSGDA
151 LDVFIRSVEGESAAEISRDLGIREESVYVLKHRVKKRLVRESYELRRELE
201 FPDHQPTPDYTPNPDQQFTPDQNFNPANQINPANQINPADQINPADQPNP
251 DQLP

Name Aliases LCA Taxa Group Subgroup
ECFp77649
  • RNA polymerase sigma-H factor
  • RMSM_02124
  • ... more
Rhodopirellula maiorica SM1 ECF62 ECF62s4

>ECFp77649 ECF62 ECF62s4 Rhodopirellula maiorica SM1

1 MNIQSHNLLTRISLLKLAQSGKDHPAWEELLGYYEPFIGRILTHMGVARS
51 DVDDVCQLVLMRLWKDLVNYQHEPQRARFRTWLSYLIHSTLVDWHRKRRS
101 DRHTVDSGSIDVEQLLIDRPELELQIEAEWKEHIVDLALERLRTIFSGNA
151 VDVFVRSVEGESATEISQQLNISEESVYVLKHRVKKRLVREAYELRRELE
201 FPDNNSSS

Name Aliases LCA Taxa Group Subgroup
ECFp83185
  • ECF sigma factor
  • RMSM_05020
  • ... more
Rhodopirellula maiorica SM1 ECF62 ECF62s4

>ECFp83185 ECF62 ECF62s4 Rhodopirellula maiorica SM1

1 MAGPIHSSNNLPTRITLLERAQSGKDHPDWNELLQYYEPFIRRFLVGMGT
51 SPSDIDDVCQQVLSRVWQELVNYRRVEEKARFRTWLTRLILNVATNDYWK
101 RKRAKRVGSTDVNDLEELPYDSPEIEQRIEAEWQRHVVHLALDRMKQIFS
151 GNAIEVFLRSTEGESSAQISEDLGVSVQSVYVLKNRVKKRLAHEVKLLRE
201 QLEFPDSTS

>ECFp83980 ECF62 ECF62s4 Rhodopirellula sp. SWK7

1 MNSSKNLPTRITLLERAQSGQDHPDWNELLQYYEPFIRRFLIGMGTAPSD
51 VDDVCQQVLSRVWQELVNYRRLEEKARFRTWLTRLILNVATNDYWKRKRA
101 QRVGSTDVHELEDLPQDDPELEKRIESEWQRHVVRLAMDRMKQVFSGNAI
151 EVFLRSTEGESSAEISEALGVSVQSVYVLKNRVKKRLTHEVKLLREQLEF
201 PDSPS

>ECFp84804 ECF62 ECF62s4 Rhodopirellula sp. SWK7

1 MNSQSRNLPTRISLLELAQSGKDHPAWEELLDYYRPFIRRILIHLKVSVS
51 DVDDVCQLTLVRLWKDLVNYEHQPKRARFRSWLSHLIHSTAVDWHRQQRR
101 NREAMDADSPEVSEMLIEESTLEQQIEEEWRDHIIGLALERLKTIFSGNA
151 VDVFVRSVEGDSAAKISADLNMSEESVYVLKHRVKKRLVREAYELRRELE
201 FPDK

Name Aliases LCA Taxa Group Subgroup
ECFp86928
  • RNA polymerase sigma-H factor
  • RSSM_02919
  • ... more
Rhodopirellula sallentina SM41 ECF62 ECF62s4

>ECFp86928 ECF62 ECF62s4 Rhodopirellula sallentina SM41

1 MSTLDSKETGESATRESLLRRAQADAHGSAWEELLQYYEPFVRRTLRAMG
51 VEEGEADDVCQQVLAHLWGRLVDFQPDHERARFRTWLTRIIRNTAVSEYR
101 KRMRRQRVSFAESSILESLAGDSSDIEQRIEDEWQRYLVDLAMERIDEIF
151 SGNAVEVFLRSVEGESAADIGQSLGIHVDSVYVLKNRVRRRLVHEIKVIR
201 EMLEFPS

Name Aliases LCA Taxa Group Subgroup
ECFp88886
  • RNA polymerase sigma-H factor
  • RSSM_05158
  • ... more
Rhodopirellula sallentina SM41 ECF62 ECF62s4

>ECFp88886 ECF62 ECF62s4 Rhodopirellula sallentina SM41

1 MTSQSHNLPTRLSLLELAQSEKNHPAWEELLDYYRPFISRILVHLGVAKS
51 DVDDVCQLTLVRLWKDLANYQHQPKRARFRSWLSHLIRSTAVDWHRQQRR
101 NQKMVDTDSPVINDILMAESELEQRIEVEWRDHIIGLALERLRTIFSGNA
151 VDVFVRSVEGESAASISEDLNMSEESVYVLKHRVKKRLVHEAYELRRELE
201 LPDDV

>ECFp91130 ECF62 ECF62s4 Rhodopirellula sp. SWK7

1 MNSQSQNLLTRISLLELAQSGKDHPAWEEFLGYYEPFISRILKQTGVARS
51 DVEDVCQLVLMRLWKDLVNYQRKPHQARFRTWLSYLIHSTLVDWHRQQQR
101 DRLVVGSDAFLFEQAMIDQSELEEKIEAEWKEHIVDLALERLRSIFSGNA
151 VDVFVRSVEGESVSEISKQLNISEESVYVLKHRVKKRLVRAVCELRRELE
201 LPDGTP

Name Aliases LCA Taxa Group Subgroup
ECFp93214
  • ECF sigma factor
  • RSSM_06848
  • ... more
Rhodopirellula sallentina SM41 ECF62 ECF62s4

>ECFp93214 ECF62 ECF62s4 Rhodopirellula sallentina SM41

1 MQSSRNLPTRITLLERAQSGKDHPDWNELLQYYEPFIRRFLIGMGTSPSD
51 VDDVCQQVLSRVWQELVNYRRVEEKARFRTWLTRLILNVATNDYWKRKRA
101 QRVGSTDVSNLEDLPQDSPEIEQRIEAEWQRHVVHLAMDRMKEIFSGNAI
151 EVFLRSTEGESSAKISEDLGVSVQSVYVLKNRVKKRLAQEVKLLREQLEF
201 PDSPE

Name Aliases LCA Taxa Group Subgroup
ECFp76760
Gemmata sp. SH-PL17 ECF62 ECF62s2

>ECFp76760 ECF62 ECF62s2 Gemmata sp. SH-PL17

1 MAEPPLTRVTLLTRLRDGRDADAWREFVQLYGPVVYRFARNRGLQDADAA
51 DLMQDVLRSVARNAHRMEYDPKRGTFRGWLYTVTRNKIYNFLSSQRNRPR
101 GTGDADAQERLDATPAREEEGPDADWEKEYQRRLSARAMELVRGEFQPNT
151 WAAFWQTAVEGKSAAEVGTELKMSPGAVYVAKSRVLARLRDEVQKIMVEE
201 DAA

>ECFp76775 ECF62 ECF62s2 Planctopirus hydrillae

1 MDRVLQNSPITRVSLLIRLRDAADHSAWQQFAELYGPVIYRFARGRGLQD
51 ADAADVMQDTLRSVSNAIGRLDYDSAKGSFRGWLFTIARNKIFNLLSSRK
101 NKPRAAGDTAAHELLQATPSDDNSLEESWEDEYRRRLAGIAIERIKGEFQ
151 PNTWEAFWGTAVNGESATDVGERLGMSSGAVYVAKSRVLARLKEQVQRLI
201 DEEDQ

Name Aliases LCA Taxa Group Subgroup
ECFp76743
  • extracytoplasmic function alternative sigma factor
  • RMSM_06978
Rhodopirellula maiorica SM1 ECF62 ECF62s2

>ECFp76743 ECF62 ECF62s2 Rhodopirellula maiorica SM1

1 MLSSSKAAQDSNLTDSPITRATLLLRLRDGEDNEAWAEFLRDYGPMLYRF
51 ARSRGLQDADAADIVQDVIRRVGSAISRLDYAKEKGGFRAWLFTITRNRL
101 YTYFEKRKRLGPTANDTAQYEMLSQAPQASNELHEAWEREHQRQLAGQAM
151 KEVEPEVEPQTWKAFLMTAVDGISAGDAAKQLGMTTGAVYVAKSRVIARL
201 KTVIERLQQEDQ

>ECFp146583 ECF62 ECF62s2 Mariniblastus fucicola

1 MADIKLTRASLVFRLRDRSDDEAWKQFVDLYGPMIFRFLRSRGLQDADAA
51 DLLQEVLRRVGDSIGKLDYAKSKGGFRAWLFTITRNCLNSFFEKRKRTKT
101 TGNDSTHNAFLNQLPNDTEELTEIWEKEYQRQLMSKAIAIVRPNTDSKTW
151 AAFEMTAINNMTADEAGDALEMTRGAVYVARSRVTARLRAEVERLMEEEE

Name Aliases LCA Taxa Group Subgroup
ECFp2685
  • RNA polymerase sigma factor, sigma-70 family
  • Plim_0986
Planctopirus limnophila DSM 3776 ECF62 ECF62s2

>ECFp2685 ECF62 ECF62s2 Planctopirus limnophila DSM 3776

1 MLQNSPITRVSLLLRLRDTADHSAWQQFAELYGPVIYRFARGRGLQDADA
51 ADVMQDTLRSVSNAIGRLDYDSAKGSFRGWLFTIARNKIFNLLSSRKNKP
101 RAAGDTAAHELLQATPSDDNSLEESWEDEYRRRLAGIAIERIKGEFQPNT
151 WEAFWGTAVNGESATDVGERLGMSSGAVYVAKSRVLARLKEQVQRLIDEE
201 DQ

Name Aliases LCA Taxa Group Subgroup
ECFp2692
  • sigma factor
  • GEMOB_RS26050
Gemmata obscuriglobus UQM 2246 ECF62 ECF62s2

>ECFp2692 ECF62 ECF62s2 Gemmata obscuriglobus UQM 2246

1 MSEPPLTRVTLLARLKDGRDTGAWSEFVQLYGPVVYRFARNRGLQDADAA
51 DLMQDVMRSVARNAHRMEYDPKRGTFRGWLYTVTRNKIYNFLSSQKNRPR
101 GTGDADAQERLDATPAREEEGPDADWEKEYQRGLSARAMELVRSEFQPNT
151 WAAFWQTAVEGKSAAEVGTGLKMSSGAVYVAKSRVLARLRDEVQKMIAEE
201 S

>ECFp76733 ECF62 ECF62s2 Planctomycetaceae bacterium SCGC AG-212-F19

1 MAEAPVTRASLLVRLRDPQDHDAWQQFFRVYASVVYGFARRRGLQDADAA
51 DLMQDVLRRVALAAGKLDYDPRKGTFRSWLFTVTRNRLFDFLNSRQRQVA
101 GAGGSDGQRRLDEQPATPDPADGAGSWDQEYHQGVLRWAMERVRGEFQEN
151 TWQAFRQTAVEGKNPKEVAGSLKMSPGAVYVAKSRVLARLKTEVRQWQDD

Name Aliases LCA Taxa Group Subgroup
ECFp76740
  • hypothetical protein
  • BGIM_RS0106645
Zavarzinella formosa DSM 19928 ECF62 ECF62s2

>ECFp76740 ECF62 ECF62s2 Zavarzinella formosa DSM 19928

1 MSAPPLTRASLLVRLRDPNDVSAWKEFVQLYASIIYGFARKRGLQDADAA
51 DLMQEVLRSVSSAMGRLNYDPAKGTFRGWLYSITRNKIYTFLESRARQAR
101 AAGDSNSQQRLEELPNRPGDTDDWDKEYERKSFAWAAERVKHEFQPATWK
151 AFWKTAVDGESPKDVGRELGMSPGAVYVAKSRVIARLRDEISQLNPD

>ECFp76746 ECF62 ECF62s2 Rhodopirellula sp. SWK7

1 MTETPLTRATLLLRLRDTADTEAWEAFLRDYGPMLYRFIRSRGLQDADAA
51 DVVQDVLRSVGMAIDRFDYAKEKGGFRAWLFTITRNKLSTYFEKRKRASP
101 TANDTAQLELLKQESAGKDELEESWDREHQRQIAAKAMRLLQPTIEPNTW
151 MAFTMTAVDGMTAEDVATRLSMSKGAVYVARSRVTAKLRNEVARILAEED
201 AGELV

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more