ECF proteins of ECF group ECF59

Displaying ECF 1 - 20 of 41 in total

>ECFp78712 ECF59 ECF59s2 Planctomyces sp. SH-PL14

1 MQSSPSPSSSENDVELVNRAVAGDQKALGHLFTSYRPRLSRIAMFRLDPR
51 LNGRIDIDDILQETFIAAQQRLKHILRDAPDSIFLWLRMILGQTLIDLHR
101 RHLGAQARSAARDRSLDAGWDSNSTSASIHFELLGSITSPSEAMAKQEAA
151 ERLDSALQTLNDMDREILALRHFEELSNREAARLLEISEPAASLRYTRAL
201 GRLKQVMDAFPGAFPGSPFSM

>ECFp145473 ECF59 ECF59s2 Mariniblastus fucicola

1 MNTPNHPDDEDILYLREGGPQAVADLYSKYRPQLERMVEFRMDRRLLGRV
51 DAADVLQDSYMEIARRVESFLEDPAVSFFVWARQITWQTLMMSHRSHLGV
101 QKRDARQEVRLHGGGYSQGTSVSLASRLVGDVTSPSQGAIRDEQTQQLRE
151 ALDSMDSVDREVLALRHFEQLSNKEVAEVLNLGKTAASNRYVRALERLKK
201 IMDETLGT

>ECFp145471 ECF59 ECF59s2 Planctomicrobium piriforme

1 MSQQVDDSDLEGLVNDVIHGDRNALAKLFDHYRDRLWRIVQFRMDRRLVG
51 RVDADDVLQEAYLDAEKRIEHFLHDSPESFFIWLRLIVNQTLIDVHRRHL
101 GTQARDASRERSLSGGWSAESTSFSLSHHLLGEMTSPSQAALKAELAEQL
151 NLALEGMGHLDREVLALRHFEELTNSETARALGISEQAASLRYVRAISRL
201 RKILEALPGFRDRFPK

>ECFp148705 ECF59 ECF59s2 Mariniblastus fucicola

1 MKDANSSAEFDSAQKELIAEFTKHRETLWKAIFFRLDHRLGGRIDPDDVL
51 QEAWLDANMRLKQFVEERASWTMHIWIRVILRQTLVNVHRRHFSSKKRDA
101 SKEIGNTVSDGDDLPTMADCYVGRVSTPSQAAMKKESFIELETALQRMKP
151 KDRTVLTLRHFDELSNKEVAARLGLSEKAASIRYVRAIERLKKVLESPGP
201 ATSAN

>ECFp149683 ECF59 ECF59s2 Planctomycetes bacterium RBG_13_63_9

1 MTDTLGDPDELLDCLKRGDEEAVATLFSQHRKRLWRTVNFRMDRRLAGRI
51 DADDVLQESFLAAAQRLEHYVANPSWSPFVWLRMIIMQTLTDMHRHHLGT
101 QMRDAGREAVAPGCRYPQTTTVSLAAQLVGHLTSPSQAAARAEAIAEVEQ
151 AIAAMDPLDQEVLALRHFEELSNSEVAEVLEIQQKAASIRYVRALKRLRT
201 ALSQIPDFFERDQSV

Name Aliases LCA Taxa Group Subgroup
ECFp112710
  • ECF subfamily RNA polymerase sigma-24 subunit
  • OSO_RS0124480
Schlesneria paludicola DSM 18645 ECF59 ECF59s2

>ECFp112710 ECF59 ECF59s2 Schlesneria paludicola DSM 18645

1 MNDELERLQCGGEKALAELFSEYRDRLERLVDFRLDHRLSSRVDPSDVLQ
51 EAYIEIARRYREYLNAPNVSFYVWVRQLTLQALIDIQRRHFGLKRTPQQE
101 VNLKRGPSESTSDSIAQILGAQLTSPSGAAIRAEEIRQLHLALASMDEID
151 REVLALRHFEHLGNGEVAETLGLTATAASNRYIRAMTRLSEIMQRFTPGS
201 T

>ECFp161774 ECF59 ECF59s2 Fuerstia marisgermanicae

1 MPDTMNDQPASLQKTRVVVVIAIHHDRVIHGILRPVKIRPNSCVSQTATT
51 YLVREYMSDSGPHKDPSIPIEAGDEQSFIEQFSQSRSRLKQMLEFRMDRR
101 LRAREDPSDILQEVYIDAVQRLEHYRKKPELSFYVWLRQLTTQRLIDVHR
151 RHLKAEVRNVKQEVSLDHRRLAATSASMAMQLAAHLASPSQLAMRAEMIS
201 IIEEALDNMDEIDREILALRHFEELRNSEVAEVLGLKEAAASNRYVRALS
251 RLQEVLQDIPGFFDEV

Name Aliases LCA Taxa Group Subgroup
ECFp2638
  • probable RNA polymerase sigma factor cnrH
  • PM8797T_15646
Gimesia maris DSM 8797 ECF59 ECF59s2

>ECFp2638 ECF59 ECF59s2 Gimesia maris DSM 8797

1 MFDEFEDPEIFLNRLRENPEGVLADEYDRYRDRLWRIVNFRLDTRLLGRV
51 DADDILQEAYLDAATRIEHYLNDPATTFFIWLRTIVGQTLIDVHRRHLGA
101 QKRDVRREVKAKRRVFSASTSFQIANVLLGDMTSPSQAALKEELAIQLRE
151 ALESLNEIDREILVLRHFEELSNLEASEVLEIEPKTASMRYFRALTRLRS
201 ILVQIPGIIE

Name Aliases LCA Taxa Group Subgroup
ECFp2659
  • ECF subfamily RNA polymerase sigma-24 subunit
  • RNA polymerase, sigma-24 subunit, ECF subfamily
  • ... more
Rubinisphaera brasiliensis DSM 5305 ECF59 ECF59s2

>ECFp2659 ECF59 ECF59s2 Rubinisphaera brasiliensis DSM 5305

1 MNASETPDWLPGMQAGQTEALSKCFAEYRPRLERIAQFRLSPRLSTRIDV
51 DDVLQETYLAAAKRLPHCDASSPETVFVWLRLLVQQTLVDLHRKHLQAAG
101 RDIQREVRADRTDPGTSGCIAAHLVAQISSPSLSLRREEMNERLMKAIDK
151 MEPTDREVLALRHFEELSNGEVAKLLNLSIKAASIRYVRAMKKLKVFLDD
201 LPEGSFLP

Name Aliases LCA Taxa Group Subgroup
ECFp67629
  • RNA polymerase subunit sigma-24
  • PM8797T_RS21020
Gimesia maris DSM 8797 ECF59 ECF59s2

>ECFp67629 ECF59 ECF59s2 Gimesia maris DSM 8797

1 MFLNRLRENPEGVLADEYDRYRDRLWRIVNFRLDTRLLGRVDADDILQEA
51 YLDAATRIEHYLNDPATTFFIWLRTIVGQTLIDVHRRHLGAQKRDVRREV
101 KAKRRVFSASTSFQIANVLLGDMTSPSQAALKEELAIQLREALESLNEID
151 REILVLRHFEELSNLEASEVLEIEPKTASMRYFRALTRLRSILVQIPGII
201 E

Name Aliases LCA Taxa Group Subgroup
ECFp67663
  • RNA polymerase sigma factor
  • GEMOB_RS22155
Gemmata obscuriglobus UQM 2246 ECF59 ECF59s2

>ECFp67663 ECF59 ECF59s2 Gemmata obscuriglobus UQM 2246

1 MAVEAEKDIADLLGRVRGGDQPALAELFAKHRDKLRRMVQLRLDPRLTGR
51 VSPSDVLQEAYIDALKRIDHYFEKPDQPFFGWLRLVVGQRLADVHREHLA
101 QKRDIGQEVSIDRGATAADSACLAACLLGNGSSPSHAAARTESFARLEQA
151 LAAMDPLDREVLALRHFEELSNTETASLLGVQPAAASKRYVRALARLKQI
201 LETIPGFTG

Name Aliases LCA Taxa Group Subgroup
ECFp77633
  • hypothetical protein
  • OSO_RS43680
Schlesneria paludicola DSM 18645 ECF59 ECF59s2

>ECFp77633 ECF59 ECF59s2 Schlesneria paludicola DSM 18645

1 MPDGSAEHSEIVQRILTGDQEALGELFAIYRPRLWRLVTFRLHPSLQGRI
51 DAEDVLQDAWLRAIERIDHFYEGAGESFLWFRTIVTQTLIDLQRFHLGAR
101 KRSATREQSINGGWTSASTSSCLAFHLSDSARSPSSNASHAELTKQLDSV
151 LLGMNEVDREILALRHFEALNNNEVAKLLNLSEQAASVRYIRALGRLKQI
201 LELVLPDAFDSKVSKKANG

Name Aliases LCA Taxa Group Subgroup
ECFp67610
Gemmata sp. SH-PL17 ECF59 ECF59s2

>ECFp67610 ECF59 ECF59s2 Gemmata sp. SH-PL17

1 MAVEAEVEIAELLTKVRAGDQQALAELFARHRNKLRRMVQLRLDHRLAGR
51 VSPSDVLQEAYIDALKRVDHYFEKPDQPFFGWLRLIVGQRLADVHREHLA
101 QKRDVGQEVSINRGGPTTDSACLAACLLGNGSSPSHAAARTEAFTHLEEA
151 LNSMDALDREVLALRHFEELSNTETAALLGVQPAAASKRYVRALARLKQI
201 LETIPGFGG

Name Aliases LCA Taxa Group Subgroup
ECFp88995
Pirellula sp. SH-Sr6A ECF59 ECF59s2

>ECFp88995 ECF59 ECF59s2 Pirellula sp. SH-Sr6A

1 MDAFPPEPIPSSQCDGNSQDTSPCDVERVRLRKGGGEALVQLWGEQVSKL
51 ERIVQFRMDPNVRARIDPADVLQEAFLQVSKRIDEYIEGVPVSWFVWLRQ
101 KTLQTMIDMQRAHFSDKRDVHREVMRPSQPHGQTSSLSIARVLMDDCTSP
151 SVAASRHEEFEQLRRALDSMNETDREVLAMRHFEQLNNQEVAEMLGLSST
201 AASNRYVRAMVKLGEIMKSISKQSP

>ECFp165868 ECF59 ECF59s2 Fuerstia marisgermanicae

1 MSPSEPDQQLIDRVVGGDKDALATLFSQHRDRLWRMVTFRMDPRLHGRVD
51 ADDVLQEAWLAAVQRIDHFLADASRSIFVWFRLITSQTMVDIHRRHLGTQ
101 KRDAAKEFSIHKGWSSESTSFSLSFHLLGHLTSPTQAALREELSQQLKTA
151 LDSMNEIDREVLALRHFEQLTNRETAQILSISDQAASDRYMRALGRLKGV
201 LKALPGFVE

>ECFp145472 ECF59 ECF59s1 Planctomicrobium piriforme

1 MTTSCSVERDTTVISETKAMPDNSLWPEHEQTREMVRAAANGEPGAENAL
51 LDRHRNALRRLIQFRMDRQIARRVDASDVVQDVLLEASKRLRDYVADPKM
101 PFHLWLRQLAQDRMIDLHRRHHAQRRSVDREQSLRKSFGDRSSLDLAGQL
151 QDQELTPAAATIRKELEERFLEALDLLDDADREVIVMRHIEQLGNSEVAQ
201 ALQLSEAAAGMRYLRALRRLKAVLLEPGENV

>ECFp145469 ECF59 ECF59s1 Mariniblastus fucicola

1 MTIVVNGIFSDNATMWPEQQPTEELLAQAKVGDDSAVNQLMDRHRNSLRQ
51 LIRMRLDARIQKRVDVSDVVQDVLVEANRRLETYIGNPIMPFHLWLRQIA
101 KDRIIDAHRRHRVSAKRSVDREQGMVIPRGHDHSSIQLASLLGDGGLTPA
151 AAALQKEMAAKVEAAISLLDNKDCEIITMRHYEHLTNQEIGSILGLTEPA
201 ASMRYLRAIKRLKAMMQADETASGDAVG

>ECFp166677 ECF59 ECF59s1 Singulisphaera sp. GP187

1 MWPDANETEVLLKHVEQEGASAKERLWERHREPLRRMILHRLDHALERRV
51 DASDVVQEVLLKANQRLAEYLRNPVMPFHLWLRHIARDHMIDEHRRHRVA
101 ARRSLDREQSLAAPAFVDRSSMDLAAQLRDPNLTPAAAVLRLELERRFRD
151 ALNQLEDNDREIVLMRHFEQLSNGDVARQLGVSEAAAGMRHLRALRRLRT
201 ILGETPSLRGQA

Name Aliases LCA Taxa Group Subgroup
ECFp2647
  • DNA-directed RNA polymerase sigma-70 factor
  • GEMOB_RS37545
Gemmata obscuriglobus UQM 2246 ECF59 ECF59s1

>ECFp2647 ECF59 ECF59s1 Gemmata obscuriglobus UQM 2246

1 MWPNREETDRLLDEARAGAPGAVDKLLGEFRDPLRQVVGLRLDPAVARRV
51 DASDIVQDVLIEANQRLTEYLKKPDMPFHLWLRHLAQDRIIDTHRRHRLA
101 QRRSVDREQPIARPAWNDESSVSLVAQLIDTERTPTSEAIRLELQRRLAT
151 AIDKLSEDDREIVLMRHHEALSNQEVAHALQLTEAAASMRYLRALRRLRT
201 VLVPDGQERPDDV

Name Aliases LCA Taxa Group Subgroup
ECFp2642
  • RNA polymerase sigma-70 factor
  • DNA-directed RNA polymerase sigma-70 factor
  • ... more
Planctopirus ECF59 ECF59s1

>ECFp2642 ECF59 ECF59s1 Planctopirus

1 MQENTIQTDALLKNLREGNDKAVNELLERHRTPLRRMIELRLDRQMARRV
51 DASDVVQDVFMEASGRLREYLENPRLPFHVWLRHLARDRMIDLHRRHRGA
101 LRRSMDREQALPVSQENSGDQLMDQFKDDELTPAAENIRREFEERFLLAL
151 EQLEADDREMILMRHFEQLGNNEVAEILGLTPPAAGMRHLRALRKLRNVL
201 GEDGLSLPGT

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more