ECF proteins of ECF group ECF58

Displaying ECF 1 - 20 of 28 in total

>ECFp152135 ECF58 ECF58s1 Planctomycetes bacterium RBG_16_64_10

1 MALSEIDRNLIQRCLAHKPKAWEDFVDRFMGLIIHVINHTAQCRSIRLTQ
51 EDRDDLASEVFLTLVRDDFAVLQRFRGASSLATYLTVVARRVVVDRLLRH
101 RSASPLGADVYDTAGDGNQVQQRISDREQVDQLLGELEEAEAAVVRMYHL
151 EGKTYREISVATGMPENSVGPTLSRARNKMRRSGADQTTGRAQ

Name Aliases LCA Taxa Group Subgroup
ECFp111747
  • DNA-directed RNA polymerase sigma-70 factor
  • OSO_RS0116745
Schlesneria paludicola DSM 18645 ECF58 ECF58s1

>ECFp111747 ECF58 ECF58s1 Schlesneria paludicola DSM 18645

1 MALTELDRSLLERCLKRDGSAWRDFVDRFAGLFVHVIQHTAQARSVKLTA
51 ADIDDLSAEIFLAILADQFAVLKHFRGECSLATYLTVIARRVVVREIIHR
101 RLSEALGHVKSQNSNLPMTKGENQEIVRIENQELIQQMLAGLSEQDARIV
151 RQFHLEGKTYREIGDELGVPENSIGPTLTRAREKLRQSLSASMG

Name Aliases LCA Taxa Group Subgroup
ECFp118082
  • DNA-directed RNA polymerase sigma-70 factor
  • PM8797T_RS04180
Gimesia maris DSM 8797 ECF58 ECF58s1

>ECFp118082 ECF58 ECF58s1 Gimesia maris DSM 8797

1 MALTDIDRNLLRRCLAEEPGAWKDFVDRFIGLFTHVIHHTAHARSVRVTD
51 NDVDDLLSEVFLVLLANDYRVLRNFRGNSSLATYLTVVSRRVVVKKMVER
101 RMAEALGHVSTKSKMEYASEEHARHQQLVDDQEEIQNMIRQLSPTDAQIV
151 EQYHLQGKSYQQISSDLDIPENSIGPTLSRARNRMRENQSNTRTL

>ECFp118086 ECF58 ECF58s1 Planctopirus hydrillae

1 MALTDTDRDLINRCLRREAGAWREFVDRFLPLFAHVIHHSAEARSIPLQN
51 SDVEDLCSDVLIAITENDFAVLKRFRGKASLAAYLVVVARRVVVREMIKR
101 RMSEAFGHVRSNHVNSGQGSDVIEPVAPTEVRRIEHQEVIEKILSGLPAR
151 DAEVVRKYHMEGSSYQEISRQVGIPLNSIGPILSRALERMRHRVAST

>ECFp146864 ECF58 ECF58s1 Planctomycetes bacterium RBG_16_64_12

1 MALSEIDRNLLERCLQRKSRAWEDFVDRFMGLVVHVVNYTAQARSIRLSP
51 EDRDDLCAEVFLNIIKDDFGTLRHFRGQSSLATYLTVVTRRIVVKRMMQR
101 KPSGPLRDGASPQAAEDPADAGPQPEERISDREEVERLLAGLGDGESRIV
151 RMYHLEGKSYHEISQAIGVSENSIGPILSRARRKMRRVGVNQTTS

>ECFp147739 ECF58 ECF58s1 Planctomycetes bacterium RBG_13_63_9

1 MALSEIDRNLLERCLQQKPRAWEDFVDRFMGLVVHVVTHSAQARSVRLIA
51 EDRDDLCADVFLEVIKNDFSLLRNFRGQSSLATYLTVVARRIVVRELLDR
101 KSVARLADGSPQQTAEAVADPRPNAEERLGNREEVERLLGGLQGTEAQVV
151 RMYHLEGKTYQEISTAVGMPENSIGPILSRARNKMRRAGVNPASG

>ECFp152105 ECF58 ECF58s1 Planctomicrobium piriforme

1 MPFVEVDRRILDRCLRRQPGAWEEFVDRFIGVFIHVIRHTAHMRSVDLTP
51 ADIEDLCSEVFLTLLKNDFAVLRHFKGKSSLATYLSVVSRRVVVKSMTQR
101 RKSEALGHTSVHPSALRSSGVELSPQAVDQEEVRALMNQLPPSEAAVIKL
151 FYLDGLSYQEISKQLGIAENSIGPTLHRAKERLRQGKVSSAG

>ECFp164093 ECF58 ECF58s1 Fuerstia marisgermanicae

1 MPLTEKDRKLVNDLLSGASGAWNLFVDRYANLIVQVIRHTASAHSLKLNA
51 DDVDDLTAEVFTALLDRNLAAIRAFRGRSSFATYLTVIVRRVVLRKLTQR
101 RYLQAFGHVKAHQASFAETADDGSANRVDAKDEVDSLMTRLPQNLRSVVE
151 SFYLEGKSYREISRLLSLPKNSIGPMIARAKDLLRSREPESS

Name Aliases LCA Taxa Group Subgroup
ECFp2631
  • hypothetical protein
  • PM8797T_05780
Gimesia maris DSM 8797 ECF58 ECF58s1

>ECFp2631 ECF58 ECF58s1 Gimesia maris DSM 8797

1 MLRRCLAEEPGAWKDFVDRFIGLFTHVIHHTAHARSVRVTDNDVDDLLSE
51 VFLVLLANDYRVLRNFRGNSSLATYLTVVSRRVVVKKMVERRMAEALGHV
101 STKSKMEYASEEHARHQQLVDDQEEIQNMIRQLSPTDAQIVEQYHLQGKS
151 YQQISSDLDIPENSIGPTLSRARNRMRENQSNTRTL

Name Aliases LCA Taxa Group Subgroup
ECFp2635
  • RNA polymerase, sigma-24 subunit, ECF subfamily
  • DNA-directed RNA polymerase sigma-70 factor
  • ... more
Rubinisphaera brasiliensis DSM 5305 ECF58 ECF58s1

>ECFp2635 ECF58 ECF58s1 Rubinisphaera brasiliensis DSM 5305

1 MALTQVDRDLIQRCLQRQPAAWQSFVDRFSGLFVHVIRHTAECRSIPVSH
51 ADVDEVAAEVFGALVENDFRVLRHFRGKSSLATYLTVVTRRIAVRSLIER
101 RRKQGVTPIPAGASTTNGHAGEFEVENRDLIEHLISQLPDNEARIVRAYH
151 LDGKSYQEISSQFNIAENSIGPVLTRAREHLRKAGTATSKP

Name Aliases LCA Taxa Group Subgroup
ECFp2634
  • DSM3645_17956
  • RNA polymerase sigma-E factor-like protein
  • ... more
Blastopirellula marina DSM 3645 ECF58 ECF58s1

>ECFp2634 ECF58 ECF58s1 Blastopirellula marina DSM 3645

1 MALTDTDRKLLDSCLDGEPCAWEALVDRFIGLVVHVVDHTARAKGVDITV
51 EDREDLAADVFARLVRKDFRALRDFRRKCSLATYLTVIARRVTIRQLHRR
101 IRERSLQFALNGETKTPVTWTVEKRIEDRDQIEAWLESLSGLEADVVRRF
151 HLEGLSYEEISRQLGIPVNSIGPTLSRARLKIRRNNSADSVFQ

Name Aliases LCA Taxa Group Subgroup
ECFp81392
Pirellula sp. SH-Sr6A ECF58 ECF58s1

>ECFp81392 ECF58 ECF58s1 Pirellula sp. SH-Sr6A

1 MALSNLDRELLDKCLAKDTAAWQEFTDRFLALIVHVVNHTAASRNIQITT
51 ESRDDLVAEVFLSWIEKDFAALRRFRGRSSLATYLTVIARRVIVRRLSQL
101 RIPNSHTSLLFDVPGSAPAPHLHNSLDFQSALAKLSPNEATALKMFHLEG
151 CTYQEIGSRIGMPENSVGPLLSRARDKMKSLV

>ECFp82554 ECF58 ECF58s1 Planctomyces sp. SH-PL14

1 MAFTDVDRRLLKQCISRAPGGWEAFIDRFLGLFLHVIKHTASARSVALTS
51 DDVDDLCSEIMLMLLQNDFAVLRHFRGKASLSTYLVVIARRVVVRELIQR
101 KQAEALGHVAAHNNAMDAAGNISEVQRIENSDEVKLLMGVLGPSDSEIIR
151 KYHLEGRSYRQISEELGIAENSIGPTLKRARDRLREINVRSRV

Name Aliases LCA Taxa Group Subgroup
ECFp2630
  • RNA polymerase, sigma-24 subunit, ECF subfamily
  • DNA-directed RNA polymerase sigma-70 factor
  • ... more
Pirellula staleyi DSM 6068 ECF58 ECF58s1

>ECFp2630 ECF58 ECF58s1 Pirellula staleyi DSM 6068

1 MALSEIDRSLLQRCLTRQPRAWEDFVDRFLGLVMHVVNHTTITRNLAFSA
51 ADAEDLVADVFYGILADDFAVLRRFRGESSLATYLTVVSRRIVVRELLKR
101 RLPISLTDTSEMDNLAAGGGSLEQRVQDREEVEKLIDQLGGEEAHIVRLY
151 HLEGKTYGEISKVTGVPENSIGPTLSRARAKMRRQNVDSAAG

Name Aliases LCA Taxa Group Subgroup
ECFp2636
  • RNA polymerase sigma factor, sigma-70 family
  • DNA-directed RNA polymerase sigma-70 factor
  • ... more
Planctopirus limnophila DSM 3776 ECF58 ECF58s1

>ECFp2636 ECF58 ECF58s1 Planctopirus limnophila DSM 3776

1 MALTDTDRDLINRCLRREAGAWREFVDRFLPLFAHVIHHSAQARSIPLQN
51 SDVEDLCSDVLIAITENDFAVLKRFRGKASLAAYLVVVARRVVVREMIKR
101 RMSEAFGHVRSNHVNSGQNTDAIEPVAPTEVRRIEHQEVIEKILSGLPAR
151 DADVVRKYHMEGSSYQEISREVGIPLNSIGPILSRALERMRHRYAST

>ECFp118084 ECF58 ECF58s2 Rhodopirellula europaea SH398

1 MSLSDVDRQLLQRCLDREPRAWQDFVDRFVGLVVHVVNRTAMGRGLSMDE
51 ATRDDMVAEVFLVYVRHDFAVLRRFRRQCSLATYLTIVARRVVVRRLTAN
101 SAVPGNHTSASSAGSSLGSGNLANGNTVNGATNGHATPTQVNGELQRIEN
151 AEEVEHLMLRLDPREASVVRMYHLEGKSYQEISQAVGLSENTIGPLLHRA
201 RAKMGRG

>ECFp106137 ECF58 ECF58s2 Rhodopirellula sp. SWK7

1 MVHRTTAGRGISIDEATRDDYVAEVFLVLVRHDFAVLRRFRRHCSLATYL
51 TVIARRVVVRRLQQSQRESGVANEAAQAQPTTNGKHAGPSDADIQRIDNV
101 EEVEHLMTRLDPREANVVRMYHLEGKTYQEISREVGVSENTIGPLLHRAR
151 QKMHPG

Name Aliases LCA Taxa Group Subgroup
ECFp115048
  • RNA polymerase sigma factor
  • RMSM_RS29670
Rhodopirellula maiorica SM1 ECF58 ECF58s2

>ECFp115048 ECF58 ECF58s2 Rhodopirellula maiorica SM1

1 MSLSEVDRQFLQRCLERAPRAWQNFVDRFLGLVVHVANHTAESRGISLDQ
51 STRDDLVAEVFLALIANDFGVLRRFRRNCSLATYLTVVARRVIARRLAAS
101 QRGLQTSSQLETANLDGVGDNGHQSRIENREEVQQLMLRLDPQEANVVRM
151 YHLEGKSYQEISQSVGMAENSIGPVLSRARSKMRGEAS

>ECFp118087 ECF58 ECF58s2 Rhodopirellula baltica WH47

1 MSLSDVDRQLLQRCLDREPRAWQDFVDRFVGLVVHVVNRTAMGRGLSMDE
51 STRDDMVAEVFLVYVRHDFAVLRRFRRQCSLATYLTIVARRVVVRRLTAN
101 SAVSGTHISASSVGSSLDNGNLANGNTVNGAANGHATPTQVNGELQRIEN
151 AEEVEHLMLRLDPREASVVRMYHLEGKSYQEISQAVGLSENTIGPLLHRA
201 RAKMGRG

>ECFp118080 ECF58 ECF58s2 Rhodopirellula baltica SWK14

1 MSLSDVDRQLLQRCLDREPRAWQDFVDRFVGLVVHVVNRTAMGRGLSMDE
51 STRDDMVAEVFLVYVRHDFAVLRRFRRQCSLATYLTIVARRVVVRRLTAN
101 SAASGNHISASSVGTSLDNGNLANGNTVNGAANGHATPTQVNGELQRIEN
151 AEEVEHLMLRLDPREASVVRMYHLEGKSYQEISQAVGLSENTIGPLLHRA
201 RAKMGRG

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more