ECF proteins of ECF group ECF57

Displaying ECF 161 - 180 of 262 in total

>ECFp26202 ECF57 ECF57s2 Planctomycetaceae bacterium SCGC AG-212-F19

1 MAALPFGTALRHVLHRIEPRPAGDHSDGALLARFTADGDETAFAALVARH
51 GPMVLGVCRRLLGDQHDAEDAFQATFLILARKAAALDGRQPLGSWLYTVA
101 RNLALKHRARGARRRMREQEAGTMPKTGPQDETAWREVCTVLDTELGRLP
151 EKYRAPLVLCHLQGMTHEAAARELGWPAGSMAKRLTRGQELLRQRLVGRG
201 ITLALPGLLALMAQKGSAAVPPPLAAGIGMAAPLFAGGKTTAGHVSVQAV
251 ALAGRALHSMTLTKLKIAAVGLLGLVTLGAGTAVCLRAGGNEASPLAAVD
301 PSPARPAAPAAEAREVPPAADAAVAEHLRRKLDQPVNLDKGIDANTPLKD
351 ALEFLSDRYDLTLVVDEKAFEARGVQKVAEQPVSLPKLVGVRLSSVFRLL
401 LGQIELDNGEVGGIRIKGDALHILPVVACEPDDRWLPHSWRRRLLRPVAW
451 DKDIAAGTPFAAVLEQLTKQSGTSFAFDEKAFKALAVTKPGEFKIAQTKL
501 AGQSVTLNYVLDSLMAELSNDQFSVHYRVQAEALAITAAKRDSAEERALW
551 NALAVLRERGDVLRQIAASAKKLEKVVTLRKEVDAETPLRDALEFFSDEF
601 DVTLVIDATAFAAIGIPKVEEERVQLPPQKEVQLGVLLRKLLEQVQHEDW
651 TAGYIVREEYIEITPVHKNVHGQQRLSKGQLQGLWDMLAEKHWQRPVLAS
701 QTLARFPEQAVALLRERLPPAPPADPKKAAEASRWVKDLASDRFPAREKA
751 AEELDKLGSAAVPALRAVLEAKPTLDLRTRVESLLAKLEVPMSRERAREL
801 WAVHLLEEIGTPEARAVLETLTKGARDAWTTDKAKAALERLNN

>ECFp26255 ECF57 ECF57s2 Planctomyces sp. SH-PL62

1 MMGRNSGKRGGMIGTVHGLQSLLEVGATGGLSDAQLLDRFVARREEAIFG
51 AIVDRHGPMVWGVCRRVLRDHHDAEDAFQATFLVLARRAGMVSPAERLGA
101 WLHGVAHRTALKARATRAKRLARETSVCAASEPWETPREARDALSESLDR
151 ALAGLPEKYRTPIVLCDLEGQSYAEAAERLGWPIGTLSGRLSRARSMLAK
201 RLARRGVAMTAGALVASLSREAASATLPATRLAPLLKAACLTGRTPWAAL
251 VSTEVVALSQEVHGGILMTRLKTTGLGLLTAGMLATGIGVLAQGQDGEPT
301 TQESPAPSPKSAPKRKAPPTTVTYFIGDLILDDPTKPPEVVTFADPTTPS
351 VSRPQVDMSPMIELITSTIEPEHWKEKDGSARDITPFFLSRSLIIRGEPE
401 VHERVGALLRGLRRFQDEQGTAFGTNGLHQPQTYDVSDLLLSHSDPADSG
451 GGPDAQALIKVITSTISPSRWVARGQGSPYVATGPREGELVVSHAKLGHE
501 QVSALLAGLRLFRHAKSAEPTPTPTPTPTPTPTK

>ECFp26261 ECF57 ECF57s2 Planctomycetaceae bacterium SCGC AG-212-F19

1 MASAPFGTVLRHIFQRMGTSPGADPTDDGLLARFTTDRDEAAFAELVRRH
51 GPMVLGVCKRILRDPNDADDAFQATFLVLARKATPLDGRRPLACWLFTVA
101 RNLALNHRLAAARRRAREKEARAMRSTEPGEQTAWDDMGEVLDAELGRLP
151 EKYRAPLILCHLQGLTHEAAARELGWPAGSLAKRLTRGLELLRERLVGRG
201 LALPAAGLAALIGEHASAAVSPSLVIQISRAASLYALGQATQGLVSTSAS
251 ALAEGALPALFFPRWKVAAAVLFAISVLGAGAAVLGHRSELPPVATPAVP
301 QDKRAAPPATADPRDQDVRRRLARVVVLERGIDPNTPLKDALEYLTKRFD
351 LEFRVDEKAFAAAGVEAVDERTVSLPRLAVPLGTILRLLLRQIDPDNGQV
401 SGYRIEQGVVVLAPAFYDTAEERFPRGLPQRLFQPVRCDREPYDQTLADA
451 LTAYGKLYGQKLVLDHKAFAEVGEPDPDRYPLAGRGRELAEEPCLLEILN
501 LILWQVDGPTWKSYLRVQDGALEITAAKHDSAQAKMLAAHREMIDEYWGM
551 WTGTPRGDVTLRQKVLLDKGIDPNTPLIDVLEFLSDRWDLTIVVDELAFA
601 GAGIENVREFPVQLEPQRTTIPLEKALRRILDQVKTDTYTAGFVCREGYF
651 EIIPEHNQLRQKKPLEARHLDQLWQDLAARSEGRSRLAVQTLAQAPREAL
701 PYLKVRLKPGGPPERDRGARARKLVAELDSDQFAVRERATEELEKWEYDA
751 IPVLRERLAEKPSLEVVRRIERILQKLGAQSPNPELARTLRSVRVLEAIG
801 TREAQQVLETLASGEPEGLPTRAARAALERIRP

>ECFp26270 ECF57 ECF57s2 Planctomycetaceae bacterium SCGC AG-212-F19

1 MPQGQLGSLLRHIRRLIGGAEGADAPDALLLRQFVEHGDEAAFTALVQRH
51 GPLVMGLCRRVLPDAHEAEDAFQAVFMILAKRAAAIRRPEALASWLYGVA
101 YRVAARARAGYRKRATRESQVTAMPGTDPSPDERVSREADPLSEANRREL
151 RGVIDEELNRLPEKYRLPMILCYLEGKSNEEAAQQLRWTKGTVSGQLARG
201 RDLLRHRLARRGVALSAGAVVAALGASAGLAAVTPALVETTVQGALLFNA
251 GKAVGTGAAAAATLAQTTLHGMFLAKVKVAAAVLAGVMVLGSAGGLVAYQ
301 SWQDHRHAGVAVASTTDQPQPTEPQARNFDPTRSDQVALVLRVKKQGDDR
351 QAQGRRWQEVVILEVLKNSPGHAVGHTMLVASTNHKHGLPAEECTIYLEP
401 IRPGDGHWQLLGGGAPEGISHPAAVRPPAHH

Name Aliases LCA Taxa Group Subgroup
ECFp26289
Gemmata sp. SH-PL17 ECF57 ECF57s2

>ECFp26289 ECF57 ECF57s2 Gemmata sp. SH-PL17

1 MSAARPAEILRQLEHPSAPDVELLTQFVLTKSAVAFEELVRRHGALVLGV
51 CRRVTRNPQDAEDAFQATFLVLAQKAVTLRSDVRLWSWLYGVAFRVSWRA
101 RRAALRRRVREVLVSKLPEPHAPRPSPERPELGPILDEELAALPECYREA
151 IILCDLRGASREEAATALGVPEGTLSSRLANGRKKLAARLTKRGIALSVS
201 VLPIAVAETQGATAVPIELLRKTCELVADYASSGTIPGPLAELTKRGLVV
251 RKTLVFGLVTVVAITGAVIAANPIAAPPADPPKPPATAKTEVVTLPQGEQ
301 KALPALATAPRIIAGWDLPITNPERVIWAPSGDRLAVAGAIRVQPDGNAW
351 FQPAFVLVKYTGKSDPENIVRTAMPRNGSVVGFTPDGKQLITDRRERHLL
401 SGLHQLVYWDPEKAEVSPVNSIPSLQNKAKLRTVSFDGAHVDGTYIFDSN
451 GKTFRAMTNEPGTGEAPKTLDVIEVDTATGKAGKPLATIPRVPCALSPNG
501 KRLAFMAPNKSSVRVYDLDNRDKPELSAFALPGKVDAKRDTMLLPCTFSP
551 DGNRLVVFHGSDQSPYQAFIVDILTGKSVAALEGEPSWSQAVFSSDGRLL
601 AMTETNVLAIWDTSTGRKLKTWKMATAVFAFHPTRPLLVVAEPNGESETR
651 LGFWDFSAEVEKK

Name Aliases LCA Taxa Group Subgroup
ECFp2603
  • hypothetical protein
  • GEMOB_RS23530
Gemmata obscuriglobus UQM 2246 ECF57 ECF57s2

>ECFp2603 ECF57 ECF57s2 Gemmata obscuriglobus UQM 2246

1 MSAPLSSLLGHVRGLDSARGASATDAELLSGFAAHCDEAAFTTLVQRHGP
51 MVLRVCRRVLRHEQDAEDAFQATFLTLARRAAAVRKGEALASWLHGVACR
101 TAASARRAAARRRAHEERARLAPVTAPGEEFAWREVQSALDEEVQRLPEK
151 YRAVFVPCCLEGESRAEVARQLGEKEGTVSSRLAEARNLLRRRLARRGIT
201 LSALLTAVAVTQGTGRGGVPAALARSTVRAAGMLARGASAGVSHRVLTLI
251 GRGGVNRPGLVTGALVLTLLAAGLVVGAATTADQPPAGDSPVRSPVAALA
301 PEEPVRNPERTDRHGDPLPEGAVARIGTQRFRHGGGSVNRVLPTPDGKML
351 VSKNYYGDASVLVWELATGRLLHQFPGHYKENRAVALSPDGKTLALGQDK
401 VIRFYDLTSGKEVRNLSSSIGGTDGLAFSPDGKVLASGHGCNTVLLWDLA
451 GGKVQSQLQAEQNQVSNLVFSPDGKTLATGDTIDTLIRLFDVATGKERQQ
501 IRCAVFAREFAFSPDGKTLAVGAQEGAASLWDVTTGKPIRELHSPNKYVR
551 SLAWSPDGKSLATGDLDDETQVVAVRLWDPATGKELRQMQMNGAVGMAES
601 LAFTADGKTLICGGSHGVIRLWDPATGAEKSPTGLPGPVRHMAVSPDGKT
651 LAFSARDITLWDLTAEREIGTLPGHHWSFTFAPDGKTLAGGNDMNGLNVW
701 DVTGRRLLSQVKVDPQKENLKWVAFDCVAFSPDGKVIATAGRELNETAGR
751 ELNGSDRYPVVRLWETATGRQIREHCYKDEIYDMPGSVAFSPDGTLLVTS
801 GAVLERDGAVCVLDMSGAQDQSRLQQMINRSLGKTKRRFIGQIPEPRVAF
851 SPDGRLLAMNRSEEGIPVWEMATGRERCLLRGHDGPTSAVAFSADGRTLA
901 SAGWDHTIRVWNVETATELKRLKGHRGQVNALVFTPDGRRLISAGNDSTV
951 LFWDVLDLTRRPRPALRLGPSEWDALWADLAATDAGKAHAALARLTAAPA
1001 VTVPAVRERVRPAPEPDVRLLAQLVRDLNSEEFAAREKASQELGRLGESV
1051 EAAVKSARKGASPEAARRCDELLTKLAVLSGDRLRGVRAVEVLERIGTPE
1101 AVTVLESLARGAPQARLTRDARAARDRLARSAGDR

>ECFp26111 ECF57 ECF57s2 Planctomycetaceae bacterium SCGC AG-212-F19

1 MDNRPLKPVIRYIRQMAGTVEPPADHLLLDSFRSQQDEAAFASLVEKHGP
51 LVLAVCRRVLHNEHDAEDVFQSTFLVLAKKAGSIRQHESLGGWLYRVAYH
101 LALRVKARLVRRQEKEAEALPPDADDPAGDISWRELRGVLDEELARLPDK
151 YRMPLVLCYLAGKTRDEAAEELGWSVGAVKGRLERGRDLLRARLERRGLT
201 LSAALLGTMLASGQASAAVPATLLGATVKAAGAVASGTAVVVSPCVLDLA
251 RYGIGMFGVGKIKVAAVLLVAFLLTGLGVVMLGGNPFGANLADGDLGPSA
301 PPPAPAFVDITKECGLEKIVADKYAASPKWWLSGLHLVDLDGDGHLDFFM
351 SAHGEGGAVAALNDGKGNFKLAPGNYPSTEIHLAYDVNEDGLIDLTMTYR
401 DGGGQWWINKSKPGTLDFEAIPASQRGTNTARRQAMIDINRDGKVDWIRG
451 TPPALIFEHGDGKGGFTNNSGRLNTGNAGRGESLCIPVDLFGSGHIDFIV
501 EYGHYDFAVGHSRVFKNDGKGNFTDVTREIGLPTDGISIKGVGDLNGDGL
551 LDLIVLEDKKPELYLNDGKGKFVKKPGALIGMDKASRVNYSSWGLAVVTD
601 IDNDGVPDIIWNGKNFLWVLRGQGDGTFKYMNAEWGIKDTCASSVDDGLC
651 FGDINGDGMLDIIGYTAIGNQRQFAVYRNNLPRQNYLNVRPIGLPGNKGA
701 AGAKIRLYAAGTQQLLWYEHVAIWDSQAAQSYYSFAETERHFGLGKRDAV
751 DVVVEFYPSGKKVERKNVKANTTVRVPESDTP

Name Aliases LCA Taxa Group Subgroup
ECFp2593
  • RNA polymerase sigma-H factor
  • GEMOB_RS51100
Gemmata obscuriglobus UQM 2246 ECF57 ECF57s2

>ECFp2593 ECF57 ECF57s2 Gemmata obscuriglobus UQM 2246

1 MAVEAARTDGQLLEAYSDHRDGAAFAELVRRHGPMVWGVCRRMLPNRQDA
51 EDAFQATFLVLVRKSASVRPAERVGNWLHGVAVRSAQKAAAARRRERPVE
101 NVPDPAVVESGVWRDVLPILDEEVGLLPDRYRSVIVLCDLEQMTRAAVAR
151 RLGVPEGTVAGWLARARALLGRRLARRGVGTPALAALISERIVSATVPAS
201 VVRTATEAANQSGFVPVGVATLTEGVIRAMFLNKIRVAATALFVGCGVMA
251 SGAVLLTRPTAAAQPPRSETTATAPQTEHPVSGSTEGYIRVARSEMSAAR
301 YKVIFCKALEAVGEHFEQIYADAYTGKIEAVRRIPDKRKVVVELRAAEEG
351 GYSVNVRVLHEAATGKPERRDVDLEQVVLRRLCARPEGRADQTVPSRVRE
401 PGDSEGDTNKRLQKEVDELRERVRALERNLSDRESGAARP

Name Aliases LCA Taxa Group Subgroup
ECFp2596
  • hypothetical protein
  • GEMOB_RS50750
Gemmata obscuriglobus UQM 2246 ECF57 ECF57s2

>ECFp2596 ECF57 ECF57s2 Gemmata obscuriglobus UQM 2246

1 MPFGSFVRQLGEGADSELLDRFIVGEDQSAFTALVGRYTPTVLGTCRRVL
51 GHTQDAEDAAQAVFLLLARNAARVRRPSALGAWLHGVAVRVARKARRRRR
101 RVQPLPGSSPPAAPPAPSWEDARLVIDEALAALPEPLRAPLVLCYLEGLT
151 RDEAAARLGWPLATLRGRLERGREKLRARLARRGFALAVGLLPVLLETPV
201 AAAPNWSAHTAAVATGTAPPTPAVAALATGGFPVFRPLVCFAALALAGAA
251 TAGWYLTAPPEPIAPPAPKPVARALAPDPQAGLPEKLLEGAWQSTAAGDG
301 AVRTETLRFVDGKHLVWQVHLRSPGVDTNATLRGRYELKNGTLTYQVTDR
351 WAGEESVRVRPEDALRKYQLTWAKDRTEFELKNADTGTVRKFRALKDKET
401 VAPVPDALKAIERKIQKEPKYVGEPRYLLLAFGPEAKFLVWAVSDGTTLY
451 VDRNGNGDLTDDGEKFARPKRDHTSGTRRALTFTGIELTEPGGTTHKIEV
501 LTVLYLETGSVAADVLAQAKGRPLQRALGDLWWGDAARTAQVLLFGGAEV
551 VCRPWVSGRSLLNAAAPAEFTVQVGTPGIGLGSFTAFSNDQVPKGAGPVA
601 EIEFEPLVAGAKPITVTVNLTDRDSGDKFFARVTVPDGVKAGVEAAKVKL
651 SFPNCPWGPVGASTHRVDVKPK

Name Aliases LCA Taxa Group Subgroup
ECFp26205
Gemmata sp. SH-PL17 ECF57 ECF57s2

>ECFp26205 ECF57 ECF57s2 Gemmata sp. SH-PL17

1 MNRLRTGPLPVVQLRDALRSDLDALPDAELLDRFVRYADHPAFEVLLRRH
51 GPMVFGVCRRTLINVSDAEDAFQATFLVFIRKARSLRRADRLGPWLYGVA
101 CRVAMKARARAARLAEYRTEVHEMFSDPNVPAAVPDWLPVLDTELAALPA
151 KYRDALVMCELEGASRADTAKALGVPEGTLSSRLARGRELLRRRLLKHGT
201 LLPTGGLAALLTTNGVGRAVVPAALLARTSELAVAATSAATGAVPVGAAQ
251 LTDEVLKGMLLTKLRGAGVVVLALTLVATGFATAWSGEEPRAAAEDKSIG
301 AAPPARAAEALPQPDAKKLSVGGPKLSDRDAVQGLWVNEKLNVIGKQLTE
351 GELKEANEMTGRMQILVSGDKWWTMGTGPNGVLGTAVAQLAVIDETKNPK
401 WLDLRVWPVTSHGSHWRCIYELDGDVLRICMCAGDHTSTRPAEFEADPGT
451 SLMVMTFRRGKLPPAVGEKSLVGSWVGEPPAGDSSTVRPRVEILDSYLFV
501 TNPKTGHWVGGRYRYDATKNPKWVDVELTTAIEDGKVTKLYGSYEVTDRG
551 LKLALGATGKRALRPLELDAGSDVMYFNVKAAKGPPAAQTGTPEKVITAP
601 VPHAKSRVLEEDEHIQALMNTCNFSGAEIFIRKHLADYKGLELAARSLQL
651 GICLTQRAAQSDASVAITLRTEAADRFREAITEVETYQKDSGTDKRAVFV
701 RTQAELRFLGVYQQAGKSDEVITAAGPMLERYKGTVEELVILRVTYHAHS
751 KKGDATQAQKTRDRMKTAFEKLKDKPGAFPESVGEHSRAYWEKIWFANDL
801 AVTGSLP

Name Aliases LCA Taxa Group Subgroup
ECFp26311
Gemmata sp. SH-PL17 ECF57 ECF57s2

>ECFp26311 ECF57 ECF57s2 Gemmata sp. SH-PL17

1 MNQNLHVIRRVTAEAMQTDGQLLDAYSDRRDGAAFAELVRRHGPMVWGVC
51 RRMLPNRQDAEDAFQATFLVLVRKSASVRPAERVGNWLHGVAVRAAQKAA
101 VAARRRERSVEGVADPAIVESGAWRDVLPILDEELSLLPDRYRSVIVLCD
151 LEQMTRTAAARRLGVPEGTVAGWLARARALLGKRLARRGVGAPALAALIS
201 ERVVSALVPAPVIRTTIEDANRAAPTPVGVATLTEGVIRTMFLKKIRSAA
251 IAVLVGLGAVASGAVLLTRPTVAAQPARTEATGATALVKPVERPAANPPE
301 NCVHVDRGLEPSAARYRALFERTLYVLVEHFGQITSANAYEGRIETRQPF
351 GNRTAVVAIRAAEEGGGYLVEVRILHEAGGGKPTGRDVDLERVILRQLAP
401 QTEIRSGDRAVPTARTGATSSSSQQQIEARPDPTTPRAQKPVESKDDQVR
451 RLQKEVDELRERVRALERRLSNRENGASPPAKDGR

>ECFp26253 ECF57 ECF57s2 Planctomycetaceae bacterium SCGC AG-212-F19

1 MTDEQLLERFVSQRDAAAFEELVRRHGPMVMRVCQRALRHAQDAEDAFQA
51 TFIVLARKAHVIAKGSTASWLYGVAYRIALQTRDSANKHRAREQAVPDRA
101 LASPDQKHPGVTAEDRQALDEELHRLPEKFRAPLVLCYLEGKTTDETADQ
151 LGWSRGTVASRLSRARDRLRDRLSRRGVMLGTAAVATLLTHQVATAAVPA
201 ALGTATTNAAVAAVAGKAVGATAAAGALADSALKAMFWAKMKLYGLIMAS
251 AAVVAVPAVILLPPSDPGLVGHYAFAEGSGTSVKDASSSGNHGKLVGGVT
301 WTTGRKPGSKALSFDGQTGHVKLAQDLSRWLGSSATVAFWLNTTQRGVPS
351 DGFAVPGCVTGVDVSGNDQAVTTNDIQWGFVDETGRTGVCVGDLDLRRTK
401 QMEEILVRSKQPINDGQWHHVALTRDATLGRVAVFVDGKLSGTTLTTAIG
451 PKTSPFFSIGRKEVIPEQTKPAYHFQGLLSEVRFYNRVLKPEEIAALAQ

Name Aliases LCA Taxa Group Subgroup
ECFp26209
Gemmata sp. SH-PL17 ECF57 ECF57s2

>ECFp26209 ECF57 ECF57s2 Gemmata sp. SH-PL17

1 MSVAAVRRVISRLEPGGPRTDAELVRAIAPDGVDRESAFAELVNRHGPMV
51 LGVCRGVLADSHAAEDAFQAVFLVLARKANSIRPPGAVGGWLYGVAVRTA
101 RKSKTATVRQRRREMAAIVSAGSAPTSTGSAAPGELERAELRAIIDAELA
151 ALPDTHRAAIVLCDLQGKTRSEAALELDRAEGTVAAWLARGRKALATRLA
201 RHGVALPAAGLVAVVTPSIVSAELVSVTIGSFVGRGVSDSVLALAEGVMR
251 SLSSTPTKLVTTVLTVGVLLAVVATAPAWYAHPEPNAPPGTGAATVSGVE
301 PHAKAASSSWKEAKVLELTGWLGGSAVYSADGKVLFVGGTDGHVHAYDVV
351 SWKKLWEYRGAGHFAALAVVPDGKELAVTTKDGVMFLGALTGKANDTLEV
401 RESAPYAVAFFPDTPILSDGQLVATSRKVIFGDAREITVKSWLKWPNVST
451 ITLPVRPNGKQPSDPHAGPLAVAPDGKRVVVTGPLDKATGKNVLWAWAAG
501 SGAGNQLLEGHKATVVSAAWSKDGKWIVTGDADGIVIIWDAVKFKEKSRL
551 TLGGRVAAVAVSVDGKHTAAAVVQPQERKGKDVYSEEIFVWSTASPPKKP
601 ELISSHPVGGPFAGIASLAFHPDGTALASAFANFDHLTKLGELTGKVRVF
651 ALSVPEKPAPKPAAGHNWSQSSVLTDHAALVNGIAIAPDGKSFAAATDAN
701 VTCWDTVTRRVLWTYKPTNGNAPVLALAYSPDSKHLCVAGPTDVKRLDVE
751 TGKSAAWYDQNEIVVRFGKMHTLAYHPEGKRLAASDGYATKVQNLAQESE
801 AISIGERPEESKPLPVLPASAAWSKDGKQLALIRHKQDKSCVVLWEPGRA
851 ESEVELTGHSERITCVVWSKDGDVIASGDEKGTVILWDARTHKELWRKQY
901 GDGAGRVHAVAISPEDNTVAIAANLGARKSPERVVLLAAKDGAEIHHLLG
951 PEETAVSSLAWSSGGRFLLTGCGTPVDRAGGQAAPRVGEVVVWERKP

>ECFp164498 ECF57 ECF57s2 Planctomycetales bacterium 71-10

1 MFGVLFAEGAIGPRSDADLLRLFTTRERETAEAAFAALIERHGPMVLGVC
51 RRTLGESHAAEDAFQAVFLVLARRAPAVRVDDSLGRWLYGVARKVASKAR
101 RRAGREIPAAAASDRTPIDPVAEVAREEVRRLVDREVALLPRKYREPAAL
151 CHLDGLTHEQAAEALGVPVGTIRSRLSRARDLLRPRLVRRGLAPAAALAR
201 LDSPAAAAALPRALSAATIAAALGAGARGVAPAAALAAATVRPAITSRVV
251 ATGAVLAVVVGGSFVLRGLGVMGQEPPAAAVARPPDAPSLDDQIRQIIRE
301 HEDEEARARKAMRGLSKAELQRWRAEGGGFPNRFNTMRRILDMVAAHPGE
351 PVGRDGLVWIVGYRSASSTGEFGDLFGRAARLLVEHFADDPEVARAGLDM
401 DNEATRGRDAFLEGIYATAVGREARGLIRYGLALYLAKKSEHARYLRDQP
451 GPQTHTSIRPGDKAGPRDEIQVPLSHERRGYHEHLRMLDPATLRARSERL
501 FEEVLAEYADIPYLTAHGRELQRKVRERPSAAIEDPQEKQDREATERWVA
551 APVPTLGEKAAEQLDELRHLVEGRPAPDVEGIGADGRPIRLSDHRGKVVV
601 LSFWNSSDLRHIADDRRLVEDLPEGRFALVGAVRWDADEGARAVVERERM
651 TWPNILKGGEAIAGRYHAPRSSAWYVIDAEGVLRGKRLMFPSGVLAIVRP
701 LIAEAGRRDD

>ECFp182410 ECF57 ECF57s2 Singulisphaera sp. GP187

1 MDEKSTEGLVHDLGTLFRFGSAVGLTDRQLLDRFVEGGNAAEAAFEGIVR
51 RHGPMVLGVCRRALGDVHTAEDVFQATFLVLAFRARAITRRDSVAPWLHG
101 VASRLARRTRVLARRRPELSCALPEVISPEADGDMADLRPVFDEELGRLP
151 EKYHRPLVLCYLEGLTQEEAAQVLGWTKGTVSGRLARAKVLLRARLTRRG
201 LAPAVGLLASGTAVGGEAAALAVPPSLVGATTRAAVSVTLGLAETGAVSG
251 SVIALARGGLRSMIVGRLKAAAILLLLGALGSAVAIGYAGTEDPPAARGA
301 ALAVAVAAARSIDRPLPEGARVRMGTTRLRHEGNVVRALFSPDGRTLATA
351 GWDKAVRFWDFKTGETIPGLDLLKESSSPLAVDYSPDGHFLAVGREDGTV
401 QLWDATAKRERFRSKLPGGRVRGIAFAPDGTTFASSSSDDKCVRLWDVAT
451 GRELQSLEFRDEQDDHCGPVAFSPDGHRLALGMEPKTGERVMLRIWDLRD
501 RGKPVVFRAAHDFLLAGIAFTKDSKELISGGLVDRHVQEDAIRKKWGRVI
551 PVAKLTRWDVRNGQKLGEMDSGEILGLGGFALVLDGSTLVSAHHDRLLVW
601 DIASSRVTRTILFPPDDLDSGGGASGIAIAPDDRTIALLRNDHRIRVLDF
651 ASGKSLPAPTKSHSDSVLAVTFTPEGRTLASASADGTIRIWDTANGEPRR
701 QFDLTERGWARAVCVSPDGRLMAAVGEDPNSDTPYFGGIARLWDLSDGRL
751 LRELRFDHRATLVSFSADSRRVAVATWNAEATLGMGGKNDGPPDDTVRVF
801 DADTGQRLAELRGHDSRIVAFAFAPDGRSFVTASQDTSFRFWESDSGQPI
851 RQFDLTSHFGKGKPYRIANAAIAPDLTWALTSGERDHRLIVWDLKSGKAL
901 RTIEDEPNVGTRVAISPDGRRFCSVTTLRNSLPAGSDRIRLWDMASGREL
951 LSLATQGKPISSLAFAPDGKSMATGMADTTAIIWDLGTDIRGGVDRGKP

Name Aliases LCA Taxa Group Subgroup
ECFp2580
  • RNA polymerase sigma-H factor
  • GEMOB_RS52775
Gemmata obscuriglobus UQM 2246 ECF57 ECF57s2

>ECFp2580 ECF57 ECF57s2 Gemmata obscuriglobus UQM 2246

1 MPTEARPLTRQLLRVVLGTPDVPDRDLLARFVNARDEDAFAELVRRHGAM
51 VLAVCRRVTGRAHDAEDAFQAAFLVLAKRAGHLSRPELLANWLYGVAFRT
101 ALDARAARRRAEDRVVPTAAEPACPEPPDDNAELRRVIDEELARLPDKYR
151 AAVVLCDLEGLPRSAAARALGVPEGTLSSRLAHARKLLAGRLTRRGVTAS
201 VAAAGAVLTRDAAATVVPHNLTHTTVQLAARFALARGTVPPGAPPEVSSL
251 TEGALKAMLVTRLKQTFAAGLFACGLIGVGGALAQQLGAPAVKTAPAAPE
301 QPLVAEDAPFVAQPTKKLPEAKKIVAKGIEDDDVPYGTFPSQAVVRIEDG
351 KLVRRNRVGGAELVKQVVGDQTILGYQMTSSVQATAYDPADIAVFDIKGN
401 RLSPKAWKEMLKTDVVALISSNGSLPNPRELTMFKPDTLVIVLPTGYAQH
451 SAGGATSYFPTYGGQMLPTPPTLAVPSSPFGNTVPAAPAPNTRPATPAAP
501 RATMPPKAQPALPPPPSTGSDPFAAPPVTRGQDVPPLAPIPDSQ

Name Aliases LCA Taxa Group Subgroup
ECFp26146
Gemmata sp. SH-PL17 ECF57 ECF57s2

>ECFp26146 ECF57 ECF57s2 Gemmata sp. SH-PL17

1 MRSLIHRLQSRLSKHEGEATDEHLLGDFLAHREGVRGAPQIADEAFAAIV
51 RRHGPMVRGVCRRVLRNDTDADDAFQAVFIVLLRKAEAVRPRNRLGNWLY
101 GVAVNVARRGRDASSRRRVQELTVEVPGPEPVSNDLREVIDQELSGLPDT
151 YRAAVVVCDLEGHTRSEAAGRLGWSEGTVASRLARGRSLLADRLTRRGIV
201 LPATGLVAALGANHASAVPILSYSALLLAPSPSAEALAQEVIRAMMSSKL
251 RTVTVALLTVIGIAGTGTATVWACGGFGPRIVPPVSGTKSFPFESVETRL
301 AQSNDATPSWAQSAPASTAIAGADKPAGENAGAAKSARFVLVNPAGDITV
351 VSDRHETFVEFFRRQPVVVAVASDSLRKRLIYGEKGPLEIMTVDQASFNT
401 GGPRVAAYGASLKLVPVSPNTPVARLLEVTSANEPVVFVQDSSDKNLWQA
451 VGFTRRSLVGFFASTARVKPDDFAPADLLHATEKK

>ECFp26148 ECF57 ECF57s2 Planctomycetaceae bacterium SCGC AG-212-D15

1 MSRSPIGSVLHYIHRLVDRHGPAASTDRDLLARFIAQRDEAAFEAIVRRH
51 GPMVLAACRRLLGDADAAEDAFQATFLVLVRKAPAVARPDHLAGWLHGVA
101 TRIASKARHDRLRRTTAPLDPEIPAAEEAMDDVMRRELATVLDEEVARLP
151 ATYQTPFVLCHLAGRSNEEAARELGCPTGTIYSRLARAREMLRVRLCRRG
201 LVLSAGTLAAGLHSTTAPASVPVVLLQQTVSSGVLLAAGQTLGAGLVSAQ
251 TLSFMEASLHAMYLAQLKWTSAAVLLIVAVGASLGVAYREFGGAAAAAPA
301 LAAAADPADKPAPDPNEKLRQELKSLQDRLKAIQDKQQLEAEMKKLRAQL
351 EALEGKGDTKLPAVTYKGESVEHWLKTLRDCDPTTRLNALRAMAAIGEEL
401 GDDAPRVAVAITGILKTNGTASLIPEGLPVEGVATAAHPAQVQLQAIAAL
451 AAIGPAARSAVPKLVTMQLDELNAVHGALNAVADAPGGGFGGMGLPPADP
501 NEDGDTRGPINNAIVRIDPDGKQAVPLLLAAIQKPNLKKHVAVNAANALA
551 AYQDRAAPAAVAVVNLLRIDDDVVRQAAYKALKEMGEAVKPMAMPALLAL
601 AKGNDKNTATAAAGVLWGLWAEEAEKAGIPKTEPPGGAAPPA

Name Aliases LCA Taxa Group Subgroup
ECFp2619
  • hypothetical protein
  • GEMOB_RS52455
Gemmata obscuriglobus UQM 2246 ECF57 ECF57s2

>ECFp2619 ECF57 ECF57s2 Gemmata obscuriglobus UQM 2246

1 MNTVLQLLDAVAGAGARTDGQLLDSFARRRDQGAFAELVHRHGAMVLGVC
51 RRVLGNAADADDAFQAVFLVLARKAAAVRDRERLGPWLHGVAFNAARRLK
101 RSNLRRTARERGRAGQLEQTAGAADERAELHAALDEELARLPDRYRSVLV
151 LCDLEGRTRKEAAHALGCPEGTVGGRLARARELLAARLGARGVCPALGAL
201 AGALVPAGAGAVAPALVAALVRAVGVDELARDAARGPISSHVSELAEGVV
251 SSMFAIKLQKVTAAVLCCGLALACAAGGVRLANAQPEPEFTPVPLLTKDP
301 ALKRSRQELEERARELQDTRKRQQALEEVVPGVPRRAAIIPLRKLDSGEV
351 APMLAKFFDPRRVTIAALPGDKSLLVYADEKTHAKIRELLLQMGEPAPRN
401 VTAFRLNKTADLAGTVKTLAAAFGPDRAVLVPVPVEQVLLVYASEPDTQT
451 VQKLLANVLLPESGRLDNVFMKTVRLKNILAEDASAEVRAQFGRSVSAVA
501 LPSSRQLMLYGPVDVVEAALKVVTALDEGGTAKTFEMQFQKAAWPDVLDW
551 YAKVSGRVMSTTVKPTGTFTFAAPKPGQRYTLADVTDIINEALMQQKLLL
601 VPWHTTFFILKPSDEKLDSLIVPLISLEDLPRFGRTELVQVIVPVPKGAA
651 EELVPAVKKRLGPFGSVTTLHRADALVVQDVAENVREVCKIFGVPTDPKR

>ECFp26247 ECF57 ECF57s2 Planctomyces sp. SH-PL62

1 MGKSGKGLIVRDLDQLFRRGAVFVADGELLARFLASGDEGAFESIVTRHG
51 PMVRGVCGRLLRDPHDADDAFQATFLVLARYGGKLRDPDRLSSWLYSIAR
101 RVSLRARARADRRRAQPLVHDVPAREDARAEWSDLWPVLDAELARMPAPQ
151 RDVLVLCLLGGASEQEASQRLDCPVGTVKSRLSRAREALRGRLLRRGVAP
201 AAALAASSAESFASPASSLLIRATLATITAKAPVSPAVAALIQGVSSTML
251 SKPILVTLALAGGLGLLGLTMPAWTASPPHHPQTVEDSAVPQASEAADVK
301 VKNLQRLLVAMLQSMSATDTASFPAAAIHGPDGQPLLSWRVAILPFLGEE
351 ALYREFHLDEPWDGPHNRSLIARMPAVYRTPDIPTQAGRTRFRGFSIPGA
401 MFDPNPNPAAMGMMMGGMMSSGMTGRGGRMDGMGIGMDGSGVMSAGSGSS
451 VREGVERSGTGRGETPPEPEKAEDRDRREDDPNDPAAEGAMGRGMGISPD
501 GPLEGMGAAGAGPAPRAPNQGVGMAEITDGTSNTAFLVVASEAVEWTRPG
551 EIDADPSQAAASFDGGDPRGFVVGLVDGAARFLPPSPNRPRYLAALLSRA
601 GGEILDWSDYVPRTVPAALMPVPPLPLAEARMKPSETVAPASPVVEPPVA
651 EPSLEQRMQRVEEKLDRLLQKLDAGDPDDEATKP

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more