ECF proteins of ECF group ECF57

Displaying ECF 141 - 160 of 262 in total
Name Aliases LCA Taxa Group Subgroup
ECFp26275
  • RNA polymerase sigma factor, sigma-70 family
  • DNA-directed RNA polymerase sigma-70 factor
  • ... more
Singulisphaera acidiphila DSM 18658 ECF57 ECF57s1

>ECFp26275 ECF57 ECF57s1 Singulisphaera acidiphila DSM 18658

1 MAAKLTSGTVRDLETLFETGVVGDWTDGQLLEQFRSGPGPTAEAAFAAMI
51 RRHGPMVLRVCRGVLNDEHDAQDAFQATFLVLVRKAGSIRNRFSVASWLY
101 GVAHRVASRAKVDVARRRTHERRAATLIKELQYDSAGGLLAEQAVLDEEI
151 CRLPEKYRAVVVLCYLEGLSQDQAAVSLDWPSGTVRGRLCRARELLRSRL
201 SRRGFVLPVGAVTAGLAPREDAAIPAMLIGTLPRATLLAAAGKSPAPNAI
251 SESVIALASATLKAMSWAGIKFTFALCGVGLATASIAGVAVQFGPSLHRP
301 VPVKPTKPVVAVAPDPAPEAVPVPEIVAAPKPVPPVSAYPEPETPPSAPK
351 LDPLAGNDLPERDSVALAFPLENIKVDGDLADWPEDIIRYPVRKLFMASG
401 FRPPAGGSDLSPAFSVGYNLKEQLIYLAVVVRDDKVVVGHTSHMDTDAVE
451 VYIDGLRSEQKFSGQFANPVWQHVGLADLPVQQYIAIPGSGKIYGTPHNT
501 NPVVISGDVKKTRTRVAFRRVGDITTYEWAIQPFDRYPDQPTRLERGKRI
551 GFDLAVADKDVPATSSQGMDEPAFARLAWVYWGPQWTGMKVLDAGNLGEL
601 ILAAPR

>ECFp26305 ECF57 ECF57s1 Planctomycetaceae bacterium SCGC AG-212-D15

1 MPTAALSSVLRFLRRVANAEGDTDEGLLARFIGRRDEGAFEALVERHGPM
51 VLSVCQRIVRDPHLAEDSFQATFLVLARKAGAIADPRSLASWLHGVAVRV
101 ARKARGQEAQRRSKLMTLESRSAGHADSPSGLDDLKPLLDEEVNRLPAKY
151 RELVVLCYLEGMTNSEAARQLRCPEGTVFGRLARARRMLQTRLVRRGITL
201 SVAALFERLIPETQGVTLPPALAAKATAVVGSSAGVSPIALSLAHEVMQA
251 MLCAKIMKVTVVTLMLVALAATLGVMGADVPGTLRALARSTPLRPGEEKK
301 EQPPVDPQAVDKAVADGLAWLVKQQEEDGSWPGKDREKIENTSLTLLALL
351 ASGHTHKTAIVEVQPTYAKNFERGLKFLLTQQDRTGAFDSDDLSAHAKAT
401 MVVCEAYVMTLDPALKGPAQRGLNFIANAQQDSGGWPLRLKADRWNRELH
451 AASITSTAWQLSALKSGQIAGRDIPAKTLDGAQKFLDACAGGDTAAYAVA
501 PKGKITPAATAMALRGRQFLGWGPKNPGIEKGSQWLARELNPKDLDFDAL
551 FFATQVFDDVGRDTANEWNAKMLTALLQYREEGRTSMPVRVRTRALAVLS
601 LEIYHRRLPTFFRK

Name Aliases LCA Taxa Group Subgroup
ECFp26310
  • RNA polymerase sigma factor, sigma-70 family
  • DNA-directed RNA polymerase sigma-70 factor
  • ... more
Singulisphaera acidiphila DSM 18658 ECF57 ECF57s1

>ECFp26310 ECF57 ECF57s1 Singulisphaera acidiphila DSM 18658

1 MAIGRDRAYLGELRTLFNVGAVGELTDGQLLERFAAAQGEAAELAFEVLV
51 ERHGPMVLRVCRGVLADSHEAQDAFQATFLVLVGKARTLWVRDSIGPWLH
101 QVAYRTAACARSAAARRRRHEQAAAERTKESQVETQDELGPVLHEEIARL
151 PDRFRAPLVLCDLEGGTYEQAARHLGWPVGIVKSRLSRGRDRLRDRLLRR
201 GIAPCAWPLAPGLRLDDAKALVSPTLVQSTIRGISQFVTSRTVLRESAAI
251 LTLEVLRTMTIIRSLKTAAVLLALAATTSGVDLLAQKEAPVVPTGDTDAL
301 STYEIKRGPLKSTFVTRGVIEATRNPSLINQVAGRTTIASIVPERTKVKK
351 GDLVCELDSTALKDQLTNQQIVVQESEMAAQKAKLERELAEITLNEYAQG
401 TYVQERAALQGAIAIGQSSLEMAEARLERTRRARQRLNDMIASKPETKTS
451 ADLLAEVDLDDRIDASEQTLVREKKGIELAKIKHDVLEKYRRNKTIHLLK
501 LDIETARGAEFAKRQTLDRERKKGANLEDQIRFCKLYAPNDGLVLYANAP
551 GGIAGQPTIKQGATVRERQIIVTVSDLEGPFWLHTKAKESYVDQLRLGLR
601 AQIKVDAFPDEVMTGAVESISPLPAPHTSLQRSNDKLYGTNVRIENRLSD
651 LRLGMTASAEILVHDLDDVLSVPLQAVRHDDGKDYVAVKKPDGNVDWREV
701 TLGASDGKRIEVKRGLESGERVVDRPLDLKIKKPIPLP

>ECFp182422 ECF57 ECF57s1 Paludisphaera borealis

1 MAGKPSGEALRSIRVLFNAGTVGGLTDGRLLERFTARDGEGADLAFAALV
51 ERHGPMVLRVCRSVLHDAHEAEDAFQATFLILAIKAGSIRGRDSLTSWLY
101 SVAYNVAATARTSAARRRSHERNAGQARPLAFTDDPRDDLGPVIHEELDR
151 IPERFRTVLVLCFLEGLTQHQAAERLGWPVGTVQSRLARGRERLGARLAR
201 RGLAPSAAVLASSLASEAAVPAALADSTVRLAVTISGARAMAIGTVPVAV
251 MQLVRKGVRTMFVNKVLTTGVAALLTAGAIATGAYAYQTAKSPPAEAPTE
301 AATKADDSQDGLLTVTGVVRMADGSPAAGATVQSFSFQLDAPPIARTDEA
351 GRFQLPGVFGNGCDLHASSADGRHQMVRKIPSIAARAVLASPVELTLLPA
401 LDHEVVVVSEGRPVAGAQVVASGTSFQVQGVTGQDGKARLRLPAEERLRE
451 LVAWHPTLGAGGKRDLDDRPREDKTELSLLPPAPHRIRVIDVDGKPVGGL
501 ELAVSFHPEDSDWIVARYIRASHVRTDADGTAVVSWAPRPKLQYVEVDFP
551 GSDWKVDETDLKQTRDGLTTIHARREQTVQGRLIMPEGADAEGILVIGSG
601 FGPGSNGAGPYARARRDGTFSLRVPSEHGFVLGIMDLKWASDRWTGLILS
651 KESAKPAEITMKVYPATPVTVQVTRGAEHEPVRNAWVDLSSKGQVNWTDG
701 AGRKHSGNGGVHAWLKTDANGVAQAGAGRGKHELRLSSGGWEETRPIDVT
751 TEKPLEFTFHRPWNGERRITGRLMLDGSPYKPSPTLATHAWAPPPEPHRI
801 PEALELKTHPDGTFEIAFDAESATLFFLDRDRGRGGFAEGVKGDANVDVS
851 MTPTATYSGTLLGVDGQPAAGQTLQMYVKGSDGKPIASQQTDEAGRFRFT
901 VVPSNAPLQFSNRHDPGDPEDYIFDRDRMFNPGEVRENAQLKLQRSSFSS
951 RNPRPATTPPPPAIPLSKSVESLCRKVGPCGMRALVALMSDDSGDAGRVT
1001 DALFNYDDERTKAVLSYLTLRVDPAQLAKEAAAIAERGWPKPAAGEIVLV
1051 ALDGDQKTIAAERIAVKDVDAAIRAGADFLKQHRPPPRNAPALLAEARAE
1101 AKRSGRRVWVIQGGPRCGPCFQLARWIEDHHATLDKDYVVVKLMEGVDDR
1151 VTEALAGLPIETGDGIPWFAITEPDGAVLAHSRGPVGNIGFPSSVEEVRH
1201 FRRMLEGTVRKISSDEVDQLINPLSSDHN

>ECFp182385 ECF57 ECF57s1 Singulisphaera sp. GP187

1 MAKSGVVARHLHTLLKLGAVGGLSDGQLLERFVTRHGEVAEAAFAALVER
51 HGAMVLGVCRRILADPRDAEDAFQATFLVLVKKARRVRVDDSLGRWLYGV
101 ACRVAARARTEAGRRQAREGEGVVDCAGPSFDSDRFDLRRVLDEELDRLP
151 EKYRVPVVLCYLEGLTHELAAERLGWPVGTVRGRLSRARERLRTRLSSRG
201 LAPTAAGLWDFPTPLPMRAVSHTLVEETVRAAIQYTTARVALGGISTAVA
251 VLTEGALKTMVLSKVKTSVALLFAMVATTMVAPAFLVASDPPALDRGYPV
301 AAAEKKSEPKRSKSQIEASELAAKAFGPTHWSANPALPVRYSSHKRGYWM
351 YAQEYERLNDGKQLRLRPVAIVRKSRNGEALKTVTSDEAIVDLDQPLGVA
401 SKSGVALKIRHVRFEGNVRFNIGRETTTPGADLAIGPLANAEFDETFLTI
451 RSDSDLTIEDRNKRITGSGLSIEHYPDDEGGGIKSIKIKKNVHVNVKESV
501 RSKVMPGQPEGVDGQGSRASLDLRCTGMLLIEWTRPKQGVKVGPPEASKS
551 PFLLLSGAVDVSRPRREQQPDQLNCDELRLDLRSDVSRGAGAGTSLHELR
601 ATGSAVWLRLPGQGITARCNEFIYKKLSPHRADETHLRGDGRNEVWVEME
651 KAGPTKGKVQSVTTIRTSDATIFEEGEGSETATTLVCGPGFLETRPSRDK
701 PVEGKTSWQDHFIMRTGFDGPDRPTKQFTLTGRPELFGPGSTTLNADKSI
751 VISLEPTAD

>ECFp182386 ECF57 ECF57s1 Paludisphaera borealis

1 MGRARVQRDVVVQQVCTLFTLGTIDGMTDGRLLERFTTFADESAEAAFSA
51 LVERHGPMVLRVCRSVLRDRHDAEDAFQATFLVMVRRARSLWVRDSLGPW
101 LYQVAHRTATRARTVETQRRRRERKAAFGLVAEVEERPPDDLDEALHEEV
151 ARLPERYRAAVVLCLLEGLPHEQAARRLGWPVGTVQSRLARGRERLKRSL
201 TRRGLAPSVAIAAASALPPKLAEATLQSALRYAATGSQAAAISSSILVLT
251 EGVLRMMTLAKLKTGLLAFATVGCLGLATAVVPRSIGAHGEEPPHFQNPS
301 AVREKAKPPEPEASVKGIPTPIDSTVLIRLEHEATVGYVRGTIIQSTPTE
351 AIILTSSHAFPSDARRKEIESTSIKVTYRGRTRDLVGAGPSARLTATAYP
401 LGQSDAELIDCDTARGVALVRIRPGEVLPVSPIVPPSWEPKSGTRMTTIW
451 GDSGEFSGKFAECSVLGMTKGLQGNSIYEAIECDLAPIQGCSGVGLFTKG
501 PDGKTNLLGGVCNFAEPGRKRGLYASPKMIYPILDKNGLSSLYQAETPNA
551 KPSGEQAPLTAEEEPKPPAPDAPARVISYPTESTIQIQIEGEKTITASGT
601 VISSTPKETIILTSARIFPPGAAKISVNFTAAIRMDISNWVSTIQTVGEL
651 IDSDLTRNVALVRIVPGRVLPASPIVPRNWKPKPGMNVATMRGFGGSVSG
701 IFVQGPILGLVKGESDNAGYEAIECNLLPKQASVGSGLFTQEPLDNTYFL
751 AGVCNFTDPQKNTGLYASPEMIYHILNKNGLSSLYQTEDPNLNSAPEPGF
801 PLQRIGPNAGAPTSEQPSAQESAAPVSGSAGADRVRKVEQRVDAIDGKLD
851 EIIRLLKKPH

>ECFp26119 ECF57 ECF57s1 Planctomycetaceae bacterium SCGC AG-212-F19

1 MAQAPISQLVGYLRRLVRMPAGDALTDRLLLERFVACHDEAAFAELVGRH
51 GAMVLGVCHRVLRDDHAAEDAFQAVFLVLARKAGAVGWQDSIASWLYAVA
101 YRTAQRSRANARRRREQERQASSMADPEALAAVDARELRALLDEELLRLP
151 EKYRAPLVLCYLEGKTNEEAARLLGWSKGTVSGRLARARDMLGGRLRRRG
201 VMLSAGGLVAIIAEQSAIAAAVPRLAAETARAAVSFAGLAAPGAVPASLT
251 SIALAEGVLHAMFLSRLRVAAMLVLALFVFGGGIALVGRPVLNAQAPNEV
301 PPTPAQPAAAAEEPPAKPADSEQAPADPLTIEPLDYINRVHVQFSETQRF
351 GLVCPRLRDPRNPNRPKLLTRDERGITNNTCVRIEGYEYLFGVEIPGVRY
401 VKENGKVMKEVPIPDKDRDRAWQSVWESEFGKIRITQSVEIIVGEQTRLY
451 DTVLVRYQVWNRDKPPRTVGLRVMLDTFIGTRDGVPFYVPPSPEETRLQA
501 ERAKLPKLPPERIAQLITDLDSNSFDVRDNAAAELAKHVHVAQEALRKAL
551 QANPALEVRRRIEQILEQRGQSGGWVETMRVFDAKSIPPFVQALESADLS
601 EPKAALAVLCPKIRECEPPSKMVICRWPQNSEARWGGTNAPGDWQYEPID
651 KNPNAPDSCVVLYWQQVNMKPNEKRELAFTYGLGRVLADVEDPAIRPAAN
701 GKMRLFSSPGATTARPFPVIAYYNGRADAKLKLTLPAGLELAPGEEAEQA
751 VGNFNRAGYGQVTWRVRATKPGTYAIEATGTDIGLATEVIRVREKSLFE

>ECFp163031 ECF57 ECF57s1 Planctomycetales bacterium 71-10

1 MRTASEGAAGRHIRTLLESGEVGGLPDGRLLERFVTGDGATAEVAFAALV
51 DRHGPMVWRACRAILADPNDADDAFQATFLVMVRRARSLWARESLGPWLL
101 QVARRTSMRARSLAQRRRLREFTAAGLKPRLAAEPPPDELGAAIHEEVGR
151 LPERYREVVVLCLLEGLPDSQVATRLGWPLGTVHSRLARGREKLRRGLTR
201 RGLAPAVAALASSRAPTEAASAAVPARLIEATVRSASRLASLGLRDAALP
251 AAVAALTEGVLRMTWIATIQSAALSLAAVGCVAVAALASPGEEQEAPDPA
301 PKAGSQEIPNPPAAETPIPTSSVVDVVVRSASRPDSPVRSLGTVVASTPE
351 ASFVLTSFNGVEIAADSAGKSQVRGEIRVAGVVGESVDVEPTSRLALLRF
401 RPGRLFPTARVLPRNRPLSIGQNMALVDGFDPAQVPSTRPARILELSGTE
451 PPEAGQAGPPGVLALLCDASPPGVDNGGAGLFLKAPDGSPPLGDLAGVFQ
501 LILPERPRGMFIGPEAIHRLLDRNGLGRAVEPKAAPTSLSASPPPSPKVE
551 ESATAAMLASTVSVIAFDGNEPGSRSYAAGTVISSTSDRSIVLTSAHIVL
601 GRAADAPGGRKKVMETIRVVLDTKDSPQGAFAAEAIQVDEDRDLAALRIR
651 PGAIIPTARVAPPSRRLVVGAPASRLDRPDPDRDRPLEVKPTTIVALDHK
701 ITNRASSWTSCTGAPKGGLSGSGLFVADSVAGGASPILVGLCNYADPATD
751 RGFYASPDMIYAALDAAGLSALYQDEASNAPPPEVAGSEIVKQGFVALAV
801 EGAVTPIALGTVISSTEEESIALTAGSIFAGPGDSPADPKRFDRKVTVYY
851 PRPRTEHSVSIPPVWGTAGEVVDYDVARNVGLVRFRPGRKLQAMGIVPTS
901 WKPTRGASAFRFLNLSVNEAPGAIREPSVMDKLGAGNYEAIECEGAPART
951 NVGAPLIVMASDDKSSAIAGVCNYSSPQDAAGYYAAPAMIYHILDANGLS
1001 DLYRKGNEAFGLAPPLPFNHDRRPPTVEEPERIDRVERRVDEMDRKLDRI
1051 LEALERSTPR

>ECFp167524 ECF57 ECF57s1 Singulisphaera sp. GP187

1 MPGAERGENDAVREVIPSFSQCLSKSDRVGAKPVTTYARDSVLKDLRTLF
51 DQGVFANLTDGELLERFVSRSGELSENAFRVLVERHGPMVLRVCRNILKD
101 PHDVEDAFQATFMILIRKAGSIRKRGSCASWLHGVARRAAAGIRTAVARR
151 REHERKCALNAAALLISQTPEFPDELPGLIDEELGRLQDHHRSPLVICYL
201 EGHTCEEAACQLGWPVGTVKSRLARGRERLRRQLIRRGVAPGLVLQAGTD
251 VLSSARTIVPVSLEARVLEESVRIAAPGAVTAALPATIAALVQAEMRRGA
301 ITRAIRAAMLLVGVGMALTAAASRTATTDDVPAPQAKDVPAPQAQPERPR
351 ATLSPIHARVVDVQGKPVEGVEVLVFQLNQPVVRVKTDHDGRIVLAQPRA
401 NEWFSLMARGRDAVAGVTHYAPIPIVFGTKFATSPPRPILPSRAENGDFA
451 RTFGTEFAPSPLKCILPSFWQGLGNGKTLSKTSETPRYPGVEVRRAVTAA
501 ARPTPRCRLPTRQVR

>ECFp182383 ECF57 ECF57s1 Paludisphaera borealis

1 MSRDAWIAPQIQRLFESGSLSGLTEWQLLERFARNGDQAAFELLVSRYGP
51 MVLGVCRRILDDAHDVDDAFQATFLVLIRRARTLGPSDVIAAWLHGVALK
101 VARRARVRRERLLQRERTSLDLEAPAPASRDGEFELRAVLDQEIDRLPWK
151 YQAPVALCYLQGLTHEETARQLGWPIGTVKGRLARARTLLGSRLSRRGIT
201 SAAGAVAGSFALDASLQAAPSESLVAAALRASMRIADGRPWDAVVSTSVA
251 DLVRGVFTAMLFSKLKIVAALVMLSGFAVTGAGVYGRQQAEDDKPDPGQP
301 SPAVAAEETPKPESEPPQAKTAADRPVPVREAPEGEASAPRSTDLAHLRD
351 EPEALRKQLTEAAEQAFQTTFDEYREKQVQPDRVYRASRLLLDARLDDAT
401 TPAARTAAYEAHYDRMGTLAGLQVRQRDGNIKRSTTLDEVRAFTAEAKFM
451 LAKSRVEPASQPPTSNSASGGDEPEVSPRTVAILAKLEETIAMNFPNETP
501 LEDILKYIKQATQGSDHVGIPIYVDPIGLSEAEKTMTSPISLDLDGVPLR
551 RTLQLMLKQIGLVYFVDDGLLVITSSDSQDSKLGPSMVKMSPLLEKQMKA
601 ERGELTEDEMASLLAQLQSINQMKKLVDQKDSVHDVTTAPPGSSMTPEQV
651 QTLLQQIKDLTAALNAANQRPKGGGFQ

>ECFp182412 ECF57 ECF57s1 Planctomycetales bacterium 71-10

1 MLRSAGGLVRDVGRLLRDGVDPAGGDARLLHRFVVDRDPAAFEAIVDRHG
51 PPVLAVCRRYLKDPADVEDAFQATFLVLVRKASGLRDGDALSSWLYGVAY
101 RVAVRARSDALRRRAREGEREGLQDAPAEPLRPVDDALEVLDSELSRLPD
151 KYRTPLVLCYLEGRTHDQAATELGWPVGTVRSRMAKGRSLLRERLTRRGV
201 DAPACLAALRAEVAAIPTVPSSLVAATASAAVRFAGLSAGLAWLGASPSS
251 STWPAARLALGVLATMSTTPWKLIGLTLACAGITAASLAAGAREAPGGPQ
301 DPPRPEASPAAEPPLPESTPTGVVGRLSEVERKLDRMMGLLESLAAKPAS
351 PAAASADSTSTAASATRPPLPAAPPSFDTRSLREIEAQLVSLERKFRLSE
401 RNISGLKGVVSTIEVETTREDAVAPARLLVARLREMQDEAADDIEKINEE
451 FGPDAAQMEDLDRRCTQANERYWKAEQALLKAGGDPTQLNEYLGPNPPGS
501 PSPEIVRLAKVAIESMKTAGRLGDIRDRAAEKRDSANPARRERALESIHR
551 RIQEIERLIAWARSHFPDVELTTAPVPAS

>ECFp26176 ECF57 ECF57s1 Planctomycetaceae bacterium SCGC AG-212-F19

1 MSSSQLSKVLRRLRHIMGDEGAPDETDGQLLQRFISHHDESAFRVLLDRY
51 GPMVMGVCRRALTDPHDADDAFQATFLVLVRKAASIQGQELVGNWLYGVA
101 FRVARRARSTLARRGLQRAEVPDMAIPGLQSETDSQEVRLLLDEELQRLP
151 RKYRVPMVLCYLEGQTNEATARYLRCPAGTLKTRLAKGRELLRARLERRG
201 LALSAGALGALLAPEAVRAGVAPALADATLHAAALYTAGTGAGVSAPVAS
251 LMEGALREMFVAKLETIAGVLLLLSVIGAGAGFLTYQALTSAKPVVAADD
301 PSVGDLPAFQGEDGGLAISVDQRIREWEPLPQERRFDEIGWANSLAEARR
351 LAAQHGRPIFLLTVTESIATGRCRASAFNVRAGALSNDAVIGLLNRSFVP
401 VYLSSLDYCEAGKAAAVAKTEIEPLRQEASRRNLPSRINQAWVLDADGRL
451 LNTLDACHAPADQLMKFLVELLEPLASEPTDSAAKPVVAPAPQSRPPQAN
501 RDALVLHLTARYLERRGDELVPMRVALGKEVNYFMKGPPAEDWIVLERTE
551 WARLLPAETATVGRSWALDSEVANRMFRHMYPPTEDNDLAKNRIDEAKLT
601 ATIVAMEGGVARARIEGALRMKHRFDPEKDDNRFVNATLLGYLDFEPARS
651 RICSFRLITTEGTYGKNPIGVAVRSVPR

Name Aliases LCA Taxa Group Subgroup
ECFp26316
  • RNA polymerase sigma factor, sigma-70 family
  • DNA-directed RNA polymerase sigma-70 factor
  • ... more
Singulisphaera acidiphila DSM 18658 ECF57 ECF57s1

>ECFp26316 ECF57 ECF57s1 Singulisphaera acidiphila DSM 18658

1 MASRRLGVTIRRIERLFHLGTVAGMSEVQLLERFVLQRDEAAFEALVARH
51 GPMVMGVCRQWLRDPSDAEDAFQATFLVLVRKAGSLRDCALLGNWLYGVA
101 YRVSLRARAESAKRRSRETARIDDRVDPQEPGSQERYPWLYEEVNRLPEK
151 YRAPIVLCYLEGRTHEEAAEQLCWPVGTVKGRLARARALLRSRLSRRGLA
201 PSVGVLTAALSGDALAAVPVSLIESTVLAASGLVAAKGVAAGLIPAQVAL
251 LMEGVSHSMFLSKLKLVAASVVIAGLVTTSAGVIARQAPGARSEHEEGER
301 SAVGSNGPLKSAGPRETVTLPNRLLGEAISGQGSPKTDQEHIGLDGKPID
351 RNEEEIPLDPQRDDPRIRAALARQALDWIAARQTNGQEVTPESEYERLLR
401 LSEWSLRLFEAERQASATKSDRVAAAEAHLARMKKALDLSVQLQQSGMLT
451 NLDSFETAFRYREAVKGVIDAKTDQTPVVGGTISGNETLPGSTGHMQTPV
501 RPGPGPLVSTDSQANYNQTSLPGPTTRASGPGVIRFIPISTPWSLPGETT
551 RATTIGEAQQQGGGGFHVATIDGGGVGRYDDADHERRATIAQKARRVAVN
601 DTSPQTKGILKKLDDPISMSFGKETSLSDILKYIKSATTGANDTGIPIYV
651 DLVGLQEAKKTMSSPVTLDLEGVPLKTTLRLILKQVGLAYCVKDGLLLIS
701 SPRGIVQELEEAESILDDESPQPR

>ECFp166853 ECF57 ECF57s1 Paludisphaera borealis

1 MGDLLHTGSFTALSDGQLLERFATRAREAGEPAFAALVARHGPLVWRTCQ
51 AVLRDDHDARDAFQATFLVLVRRAGSLWVSESIGPWLHRVAFRTAVHAKR
101 DKNRRRAVERQAAERTPAWTVPSISDDLSLAIHQEVERLPDRHRIPLVLC
151 DLEGRSYEEAARHLGCPVGTVKSRLARGRAHLQDRLIRRGITPSSAQQTL
201 IMIGAPTSVSLPPALLESTVRAAAAFAVGPLQAACGLSALSITLAEGVLK
251 VMLFSRLKMDAAVLATIIGLSTLGWLAHAAPDDSPRPAPAPRNVEKNTSA
301 PTVDLQGNWIVRGYPSGQAMSLIKIEGRRASARATLLAILMPEHYHFAES
351 TIENFQIDDKAVRFTLKIAATRPIDARVLNVVAYLPKDQAEPKVLRGSID
401 FSQQGQFPAILDRTDLKELDPKEALAAGNDELRRFNQTKDREKQVEILKE
451 MLKKYAEEPMAPVAGWALAITLADDKAPTAEVRAAVDRAIEVAARYGPEM
501 EVGTINLIVRNLVGAEDLEDLTLEYARKAEAMLRASYPVALQENALQNLV
551 NVLPKSRKIDEAAALAEIKTVEARLAKLGIPAAAETQRKPGAVHWARNFA
601 AARKEAAKAGKLVMVDFSTQTCGWCKRLDADVFPKPAVVEAMRRFVPVKV
651 DAEDGEGRPLVERYQAHIQGYPAILFLDPAIEDAHDGRIVGKIPGYTPPL
701 AFVELLNVIAGLPRDLPKLREQLKAHADDDETARRLATSLAMQGELMEAG
751 ELAGRPHGKETDPTVDSWASVYNTIGDELLIRQKPAEAAEWYDKAGRTAK
801 RPIDVYLARVGVGMTTAYQGKPEEAVKELEAAAGVVGVSGDEREFAQTLL
851 KSLKADVKTRPSTPK

Name Aliases LCA Taxa Group Subgroup
ECFp101447
  • hypothetical protein
  • RNA polymerase sigma factor, sigma-70 family
  • ... more
Singulisphaera acidiphila DSM 18658 ECF57 ECF57s1

>ECFp101447 ECF57 ECF57s1 Singulisphaera acidiphila DSM 18658

1 MTRLQPAVAFRQMRALFGLGAAGGLTDEHLLEIFSTGQREAAEAAFATLA
51 ERHGPMVLRVCQGVLGDSHDVHDAFQATFLVLVRKAGSLWIRDSLGPWLH
101 GVALRVATKAKVAAIRRQTHERRAAEAGEATCHGEYDGHASTLHEEIDKL
151 PQKYRAPIVLCYLEGLTHEGAATALNWPVGTVRGRLARARDLLRTRLIRR
201 GLVPSAATLGAILTAEGASAAPLSEPSIRTLLSLVAERSAGLAPAAVAAL
251 ADGCLRMMTMARLKIATVLLLVAFAALGLAEAARTKSPGGDHRAVQAPLL
301 ARANADADGPAKPTPPESWPAGVEVKGRVVDHDGAAVAGADILLLGSEQL
351 TVYANAGAKEGQVRSSIATQPANAAPSVKTDGQGRFSLRRSGSPANRIAV
401 VSAQMLLWEVTRKEFADANNLLITLPKPVALTLHAEIPEKPAKQEFWMTG
451 RLLNRVDWESDSVFYREIQVPNPGQRIVGSLPPAQYAIERINFTPQGRGS
501 NLMTQCERRLLPIEPGKRVDVTFDRKIGRRIEGRVRGLENVKLRYAMVSI
551 GFFGPEEQFSPGGKKSSLVTHFDVLSIGPDGRFATPLLPPNRYEFELSAM
601 RATTPNQDGQSYDGERLDSWWNLCTQEGNRRYLRKTRPRKRSPSMPTAPV
651 PPEKQAEIAGLEQAIREAGDAEISELAANLAITDDAHLFGANEFKIRALA
701 HKIAAKAIEQHLTRKKTDTTEPA

Name Aliases LCA Taxa Group Subgroup
ECFp26151
  • RNA polymerase sigma factor, sigma-70 family
  • DNA-directed RNA polymerase sigma-70 factor
  • ... more
Singulisphaera acidiphila DSM 18658 ECF57 ECF57s1

>ECFp26151 ECF57 ECF57s1 Singulisphaera acidiphila DSM 18658

1 MASGHRGAVLRQIERVFSLGTLSGMTEEQLLEHFAARHDEAAFEALIARH
51 GPMVWGLCRRLLHDPHDAEDAFQATFLVLLRKAGTLREPGQLSPWLYGVA
101 FRVASRVRSDPARRREKEGRVARPEAVDSDVFRDVDGLRDVIDEEVNRLP
151 EKYRRPVVLCHLEGLTYEEAARQLQWTTGMVKGRLTQAREQLRRRLTTRG
201 LAPSVGLAGPWGFPTTVPQALATRTAEVAAHIATAASASILALAEGAIRT
251 MLFTKLKAAASVLAVGTLMLAACAFALAQTGEKNQAVATPLPEKTVVPKP
301 SPVVGRSMEFRAVEPGTDRGIPGVQLTVRAGDLQTKAMTDETGRYLIEGI
351 PPKVVSSVAIWARKDGLVPKSITWWNDSANTRLPESYSLPMEPAATIGGL
401 IRDETGEPIEGATVYIRADSKRGDGVPVTDVFEFPAKTDAQGRWRCNLVP
451 ADTSSVSTRLVHPEYVSDQSYGDTPVPSPEQLRARSAVMVMTRGATLSGT
501 VTDAEGRPIPNAHVKLGLDRFSAPQPPSTRTDAEGHYQFHVKPGSQVLTV
551 QAKGHAPDLKRLPAVQGRERVDFQLPPAQPFFGRIVDRQGRPVAGARVVV
601 DTWRGYRTLEVKVTSDAKGRYRWEDAPADEVLVDIAMGDYMPIRRKPMTA
651 SPQGDEITLSPMLHVHGSVVDAGTGQPVEAFKVVPGIVIDGAKPPHWLYG
701 DLRSATGGRYEISLDDPRTPHVRIEAEGYQPAVSRPFQVDEGDTVYDFKL
751 QKGTTIAGIVRLPDGTPLTGAEVILVTPGLSPTINNGRITQRDRNPWVET
801 GPDGRFSFPAQSEDYSIAVFHDRGFGELSSQDLAADPVVTVRPWGRIQGT
851 YRIGSMPGGRQAIQANRQRPAIGRDLKPTFGPGTELYYLFHDLADDQGQF
901 ALDRVPPGLYLVAPVFHEPRGLTTASGQSATVEVRSGETRSVALGGKGQP
951 VVGRIVIPKGFDRQVDWSYGSFQFETALECPTPPKGLNAKEQSRWWWESE
1001 ESKAYSRAFHRFPLRIGPDGSFHVDDVPSAPYRLSIQVYEPPSGNDRSAA
1051 AKIVGMATRKFVVPELQGGRSDEPLDLGEIPLNLNKRVGDLAPAFQVPAL
1101 NGKTVALADYRGKYVLLDFWATWCAPCLAETPHLKATFEAFGKDERFAMI
1151 GLSLDASKDEPREYVAKQGLPWGQGFLGAWSEATLPAEYGVEGIPSIWLI
1201 GPDGKVIAMNLRGDQIKDAVSKALAIP

>ECFp182447 ECF57 ECF57s1 Paludisphaera borealis

1 MFNAGTVGGLTDGRLLERFTARDGEGADLAFAALVERHGPMVLRVCRSVL
51 HDAHEAEDAFQATFLILAIKAGSIRGRDSLTSWLYSVAYNVAATARTSAA
101 RRRSHERNAGQARPLAFTDDPRDDLGPVIHEELDRIPERFRTVLVLCFLE
151 GLTQHQAAERLGWPVGTVQSRLARGRERLGARLARRGLAPSAAVLASSLA
201 SEAAVPAALADSTVRLAVTISGARAMAIGTVPVAVMQLVRKGVRTMFVNK
251 VLTTGVAALLTAGAIATGAYAYQTAKSPPAEAPTEAATKADDSQDGLLTV
301 TGVVRMADGSPAAGATVQSFSFQLDAPPIARTDEAGRFQLPGVFGNGCDL
351 HASSADGRHQMVRKIPSIAARAVLASPVELTLLPALDHEVVVVSEGRPVA
401 GAQVVASGTSFQVQGVTGQDGKARLRLPAEERLRELVAWHPTLGAGGKRD
451 LDDRPREDKTELSLLPPAPHRIRVIDVDGKPVGGLELAVSFHPEDSDWIV
501 ARYIRASHVRTDADGTAVVSWAPRPKLQYVEVDFPGSDWKVDETDLKQTR
551 DGLTTIHARREQTVQGRLIMPEGADAEGILVIGSGFGPGSNGAGPYARAR
601 RDGTFSLRVPSEHGFVLGIMDLKWASDRWTGLILSKESAKPAEITMKVYP
651 ATPVTVQVTRGAEHEPVRNAWVDLSSKGQVNWTDGAGRKHSGNGGVHAWL
701 KTDANGVAQAGAGRGKHELRLSSGGWEETRPIDVTTEKPLEFTFHRPWNG
751 ERRITGRLMLDGSPYKPSPTLATHAWAPPPEPHRIPEALELKTHPDGTFE
801 IAFDAESATLFFLDRDRGRGGFAEGVKGDANVDVSMTPTATYSGTLLGVD
851 GQPAAGQTLQMYVKGSDGKPIASQQTDEAGRFRFTVVPSNAPLQFSNRHD
901 PGDPEDYIFDRDRMFNPGEVRENAQLKLQRSSFSSRNPRPATTPPPPAIP
951 LSKSVESLCRKVGPCGMRALVALMSDDSGDAGRVTDALFNYDDERTKAVL
1001 SYLTLRVDPAQLAKEAAAIAERGWPKPAAGEIVLVALDGDQKTIAAERIA
1051 VKDVDAAIRAGADFLKQHRPPPRNAPALLAEARAEAKRSGRRVWVIQGGP
1101 RCGPCFQLARWIEDHHATLDKDYVVVKLMEGVDDRVTEALAGLPIETGDG
1151 IPWFAITEPDGAVLAHSRGPVGNIGFPSSVEEVRHFRRMLEGTVRKISSD
1201 EVDQLINPLSSDHN

Name Aliases LCA Taxa Group Subgroup
ECFp111079
  • RNA polymerase sigma factor, sigma-70 family
  • DNA-directed RNA polymerase sigma-70 factor
  • ... more
Singulisphaera acidiphila DSM 18658 ECF57 ECF57s1

>ECFp111079 ECF57 ECF57s1 Singulisphaera acidiphila DSM 18658

1 MPSGRVEASVTHPEMTSVMETVGALPDEELIERFLNSGRVEAESAFRIIV
51 TRHGPMVLGVCRHVLNQHQDAEDAFQASFIALARKAGSIKDRRVLARWLY
101 EVAYRIAVRAKTSAVRKRIRERQGAEMSVTAAHNEAGWNELRPVLHEELS
151 RLPDKYRTPVVLCYLEGKTNEEAADLLQWPVGTVKGRLSRARELLRSRLA
201 KRGLALSAAFLVTSFSQNAVFAEVVPARLIDSTVDTAIRQVRLEPAFNPL
251 GIHSSRAHAFGSQIAVIATLVILAAATLVGASSWFPRLFPSAPEPISSVP
301 GADVSPLPGTCGTSPTPEQ

>ECFp26177 ECF57 ECF57s1 Planctomyces sp. SH-PL62

1 MTRLTGTRRDELACSIERLFDAGSVVGLTESQLLERFASRRDEGAFAAIV
51 ERHGPMVLGVCRRSLRDPHDAEDAFQAVFLILARKAGGLRCKEQVGNWLY
101 GVACRVAARARVESIRRRAKVATTDDGARLEVDVRKPSADDPAHALACEE
151 EWVRLHEEIRRLPGRYRGPVVACYFEGRTHEEAAALLACPVGTVKGRLAR
201 ARDLLRRRLGSPGAAVLEAVLATAFASAELRAGVPASLATETVHHALALA
251 AAPSVAWMTTPALSLSVRTLTEGVLQAMFLTQIKMASLAAILASTGLLVA
301 GASFASSQDGADDGREFAATTATTVPEKAGSPIAKATATQTKQTVGGGGM
351 GGMGMMPGMMMGGGGASEPSPAEVRQKIAGLSASISNLDENPQNEALREA
401 LASPFTLRTDEDHSTLGGLLDQIKGSVKTADGKKIPIYVDPVGLEEAGAS
451 LDSPVSIDLEDVPLKFSLRLMLKQIGLAYCVRDGVLIISSLEGVQQELLE
501 AQRELMGLHPDKVIMGPDGPSFGFGGMGGMGGGRGGMGQGMR

>ECFp182380 ECF57 ECF57s1 Paludisphaera borealis

1 MKHLTTLFQVGTTAGQTDGFLLDRFRSGPADEAEAAFAVLVERHGPMVFQ
51 VCRRILGDRHDAEDAAQAVFLVLARQARSIRRTDSVASWLYGVAARVAAR
101 ARLDAARRRLLERRGAETATAIRDAVQRDGDGLETWPELCQELDRLPERF
151 RLPILLCHLEGLTYEQAAQQIGCPVRTVQSRLARARERLRDRLTRRGLGA
201 GPAVASLAAVLNPDAASAVVSESWKHLTVQAATRYAASGVSAAMVPATVA
251 ALAEGASRAMHLHRLMRWTAALLLIGVAVSGAGVGMLARSAPPEPGRRID
301 PAPNDDRYRASFKNGATIEVVGVSTVPTGPNTWWKPDGSPLAEAPIDAIE
351 RLAGGRHQNGEARVVLLRVSGVKKVDMFRWHPTPTASYWGGRPRKNGQDI
401 PDLQYYEAVFRDRTDCEVEARLADGAWKTEVANDGKGGVGTFVNGHKFSF
451 GRARPYEAHGRSMTVFSVAHNFFEQDRRIVAVDRDGKQHAAVSYSSGSDG
501 DKKWVIDLIDAEFPLPPDQIREYQVQFRPLEEVEIKDVALNPRSADPGAA
551 R

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more