ECF proteins of ECF group ECF57

Displaying ECF 121 - 140 of 262 in total

>ECFp182391 ECF57 ECF57s1 Planctomycetales bacterium 71-10

1 MSGTIRGLLESGTALGATDGELLGRFVGRRDEAAFAALVERHGPMVLRAC
51 RSLLGDDHDALDAFQATFLVLARKGGSLWVRDSLGPWLHRVARRAANRAR
101 RDRDRRRAAERRAAEAAPSRSVALEPGRDDLAAAVQEEVDRLPERFRVAV
151 VLCELEGLTSAEAAATLGLPVGTVASRLSRGRDRLRDRLRRRGLDPKAGA
201 APVVLPAGLAEATASAAARFLPTTAAPPGVAAALAIGVLRAMSRNDVWRA
251 AALALALGASTSGVLALAARGGASEEPPPAAPPEKAAAKPEAAEVRPGVV
301 LMPVLVDGNVAATRREPVRLMLLPTSPFTVAIRSILPSGTRVKKGDVVVE
351 LDSGLLRKALVAQTAAASQARIRFQAADQACEIAKMALDEYKDGIYPAAK
401 AGAQGAVQAAESAVASSEKRAERVQRLREESARLLEKRGDAATPADVLAD
451 QEMEDRLDLARLGIQKDRLELEQARAKLAILEDYTRDKDLKMLQAEWNKA
501 QAERFSRVAEEEREKSQLVALERFIAKASIPAPVDGVVDISQLPGTGWPR
551 PGTHVQGGQVVAYIQQDDGRLVVNAEVPDETASRIRPGLRAKVTIAHLPA
601 RAGAVLDGVVESIEAQPSPSLQPTLGGPAPETNLAVIDLQDPPAGAKPVP
651 LRPGASVRVKFLIDSGPDALGVPRRGLVWYDGAYHVGVRKADGAVEWREV
701 VTGLYNDDVAEVRSGLEPGEAVVADPDPLLSDDQRRRVAIAPPPPPDLPP
751 ILWQESGGMGRGFE

>ECFp182443 ECF57 ECF57s1 Singulisphaera sp. GP187

1 MGESTDGIILKHLQTLYSVGAIGGLSDSELGERVVAGRDDTAEAAFTCLA
51 ERHGPMVLRVCRQMLHDRHEAEDAFQATFLVLASKAHAIRNQDSVAGWLH
101 GVARRVALRSKADATRRRIKERQAAIVAAAHSPEDNQGQSESWPELHEEI
151 ARLPERYREPVVLCYLEGLTTEAAAQRLGCPQGTILSRLSRAKERLRRSL
201 TRRGVAVPAGVLAAEWGSDVALAVPAALLETTVRASLNFTARQAAGAALA
251 STTAVGLARGVLYAMTLSQWKTFGAATLACVLAMGSLRAFAQFGGIGGTD
301 EAPAVKPVADDRQAALTRSVAKIQTELDEANRRNAELQKQLQAIQAELKT
351 LQANPTPASTKEAKPNQAATATPIRLPAEGFGMNAHTGFALQGGSNQYKH
401 HTFKNSVIVVSPLGDKIKIYNTRTNKTQSLQLSASKEFPLEVIPIASPGA
451 GALRLKGSNIIRIAASRSLDGKWITQDLREPVNGVVSPLGGTDIVVYLLG
501 RYAYGFSPKLQRWDVVELPNGTKGSPLAAIGMASIEGDGHVYTFDNDTGK
551 WSDVDLRAIIDAPDDNQPNDAEPNPAASESTPRATTP

>ECFp182452 ECF57 ECF57s1 Planctomycetales bacterium 71-10

1 MLRVASSAVIKQVAALFEAGTNAGLSDGRLLERFVTEGPEEAEASFASLV
51 ERHGPMVMHVCRRVLRNGHDAEDAAQATFLVLARRARSIRRMDSIASWLY
101 GVAWRVAARTRREADRRRARERRSVEASMTLRRTGGDDPEAYRELYDALD
151 RIPERFRLPILLCHLEGLTYEQAAERLGCPVRTVQSRLARGRKRLHDRLS
201 RQGVGPAVAPLAGILNRDASSAFASESWGRATVQAAVGYATGGAHAATVS
251 ATVAAIAQGATRSMTIHRLTKWAAFASMLGLAGAAALPWLLFALGSSSNA
301 APPTQGKLSLRVLEEGGGTPVEGAEVGLRADKHTQNARTDAQGVCTLDVP
351 SPPPSYFNVSIKKQGFVPASVSWERRGERAASIPAEQTVALQKGTTIGGI
401 VQDDRGRPIGGATVFVLVPINERREPGVARPSIWDYEVKTDAEGRWRCDV
451 VPAKLDDVWLRLNHPDFAGDRMYGDTPKPTLEKLRDLSGVMVMKKGIAVS
501 GRVLAADGSPVAGAKVAQGADRFGSHYPETKSDDQGRFRFENVRPGEMIL
551 TVQAKGHGPDLKRLAVGKESVDVEFRLEPPHRIGGRVVDSRGGPVAGAFV
601 AADTWRGRRSLEFRVDTDEDGRFAWEDAPGDEVLFDLGKQGFMSVRQKTI
651 KASDEEVTITLLKPLKVGGSVVDDETGKPVEAFTVTPGIDWGNGRAPYWE
701 LQSARRQSSGRYEFEFGEPRHGHLVRIEADGYLPVNSPMFKDDQGEVAFD
751 ARLKKGEGPSGVVIGPGGKPVKGASVCLVTAGAGAYLTNARPPDRRDSPV
801 VETDDAGRFRFPAQQGKFAVVALHDLGYAMVKDAELAKSSDVKLEAWGRV
851 EGTVRIGSRPGAGESVRLSVRQEGRGDEPQPYFDYRTTADSGGRFAFERV
901 RPGKVDIAREVKLSDRMTGYSHSTPIEVGPGATVRGDLGGTGRPVVGRVV
951 APGGEKIDLTFGQNSLRAALPQPDVPKGLTNEEKAEWYEAWTKTPEGKAY
1001 AEGANRNFTVKVEGDGSFRVEDVPAGDYEVNIAINEPPVGNACGIGGDLL
1051 ASARRKFTIPAMEGGRSDEPLDVGTIELAMTKRVKVGDQAPGFEVAALGE
1101 GVVKLDDFRGKFVLLDFWATWCGPCAAETPHLKSAFEAYRDDDRFAMIGL
1151 SLDQDKEAPRKYVDGNALGWRQAFLGNFGEAKLPNEYGVRGIPSIWLIGP
1201 DGRVIAKDLRGDAIKEAVGKALSSAK

>ECFp182459 ECF57 ECF57s1 Singulisphaera sp. GP187

1 MASAQLGDALRQIHRLFGEGTSTGLADGQLLERFLDHRDESAFATLVERH
51 GPMVLDTCQAVLKDRHDAEDAFQAAFLILVRKAGSIRAGDSLGGWLHRVA
101 RRVAIEANAEAARRRTKERKAGAIAAATASPAAAWDDLRPALHTEVDRLP
151 EKYRMPIVLCDLQGLTRDEAASQLRWTEGMVRSRLAKARRLLRSRLTRRG
201 LAPATVLFGGSARGAVPETWVTATTQAASTAATNGLGTTSAATLVAAVLK
251 AMSLTKLKMVAATALTITALAAYGAIAIRDNRDESSVQKNEKNVRSPASV
301 PLAEVPPATPRPDQTGSIVFHGRVLDPDGRPREGARLYLFQKGRETSPRP
351 SPSVRAASDAAGRFRFEVPRAEFNSYFDAEPWSDVSVIAVADGLGLALGH
401 GPTGDEALTLRLVTDDVPIAGRLIDLQGRPVAGASVRVLAVKTPASDDLS
451 PWLDALKTRKSGFDVERDFLPGYWYRPEESPIVAPVVSDSDGRFRITGIG
501 RERLATLVIEGPTIESFVINAMTKGAETIRVPSYRSPGATADVTYVGNRF
551 EHVAGPSRPVEGTVRDKGTGRPLVGVTIQAEEELDGSSNPIDHVRTTTDE
601 QGRYRLTGLPKGREGKVLVLPGSGQPFLRSLETIGGQAGAESAQLDIELT
651 RGVRVTGRITDKRTGRPVKARVEYFVFADNPHLDEAPGFRWSHDLGGSLN
701 DDDGTFRIIALPGSGAIAAQALEDEYLLDLGTDNDGNGILDTHPYNAIPS
751 NFNAITLIAPAPGAESAAVDLVFDRGRNLSGTVLDPDGKPLPGALISGLH
801 EAQYWEHTPLKTDQFTMSSLRPGKPRFLQFIHAEKKLAGWLMVREDETPP
851 PVVRLAPWGVVTGRLVDDDGLPRTDLRLVFSWNHKKDLPHGRLQGNGSGT
901 SGRIVPDGNGRFLIEGLAPGLLYSLEVEGKRAKRIGWAVRDLIIKPGENR
951 DLGDVRAVPSSLEEPE

>ECFp182437 ECF57 ECF57s1 Singulisphaera sp. GP187

1 MGASSVGFEPGRSVNAELGTLFNQGVTAGLTDGQLLERFSMRRGEAAELA
51 FAALVERHGRFVLNTCQKILRDNHEAEDALQATFLVLAYKSDALWVEDSL
101 APWLHRVACRIAIRAKLTASRRKLAEQAAAQEASDRSASQGRDDLGAALH
151 EAIDRLPGHYRRPVVLCDLEGRTYEEAARHLGCPVGTVKSRLARGRQMLR
201 ERLVRPGFALPAGFPAREMAQVPMPARLSDSMVQAATRITAGKTAAGVVS
251 ASVVALTEGMLKMMFIARLTRGVGAAVAVSVAVLTIGMGVIAYRTTGAPP
301 EAGGPDRAVSAASPSGNDRGPTQKGKPRRGEIIAQVADENNQISMVALDP
351 VTAKWRAIAKNLPPGPISPDGRFIVYSQLGRDHDEAELGIWIYDTTGKLP
401 PRRIFEQNGQPHWSDNGQRVVIGVPIGQGGQKFETWRVNVDGSGRTRLPV
451 PETDLVLDCSRDGSWLAMRPKGGEPAHRGALRLVHPDGTGARILAEGSAQ
501 DDLYTIPRISPDGRSVAWVEVRTEGSKDEGYNFYQIAPDGRSINFTKVKT
551 GNQPRTCRLLVLDLEGGPRRVLPVTFEPGVMVSATWSPDGSGLALNLHDR
601 KTKRGSIAQVDRDGKNFRTLPLPPGHWNVVVCGWQTLAPELRVSDLDELT
651 APDANSPRGRYRALLEKVETATPRNPQFHVGRFLELAEAVPEDRVAVDAW
701 IWIVTNGFDGPAFWRAVDRLAEPEHVKTIKVGHAALSVSHSVSPAAEKLL
751 RAVLEKNDDHAVRGLACLALGQYLKNQAERLQGMADPEKAKEWERLFLEN
801 GSTKENIARFLANNPDNLMKEAEVVFERTAREFGEVPHARNENLGQAAGA
851 ELNEIRNLCVGKPAPEIEGEDADGTRIRLSDFRGKVTVISFWADWCRSCS
901 VMYKDENAIRARMQGRPFTLLGVNSDDDRGKLKELIKQEGLTWRSWWDGG
951 GNANTPGPIARRYNVHHWPTLYVLDHHGIIRHKYLGIPDPLKLNAAIDAL
1001 VKAAEGQADVP

>ECFp182413 ECF57 ECF57s1 Planctomycetales bacterium 71-10

1 MANDTGGAALRSIRELFEAGAIGGMTDGELLGRFAARGDDAEPAFAALVD
51 RYGPMVLRACRAVLGDPHEAEDAFQATFLILAIKAGSIRRRESLASWLHG
101 VAHNVAASARAASARRRRHEEHAGRDRPAAVAAAAPDDLTAAVHEELGRL
151 PERYRSALVLCHLDGLTQHQAAARLGWPVGTVQSRLARGREKLRGRLLRR
201 GLAPAAVATALATAPEPVQAAALAMSTARLALAVAGSRALASGAVPAAVR
251 GLMKKGMRTMLVHNSIATASAALALAAGLATAAYAYQAARPEAPAPPVAA
301 EPDDADGLLTATGFVRMPDGSPAAGAIIRAFDSDRGAREVAVADAEGRFR
351 VRDEFASACNLHAATLDGSSQVVKEISPDSARTVLAEPLELALRPTAACD
401 VTASAEGRPVERAEVVATGPGFQVRGRTGGDGLARLRLPAGSPLDRIVVW
451 HPSQGAWGDVRMRDRGPAPRTVAASLRPPLPHRVRVIDEKGRPVAGVRLA
501 ASFQVEGGVWIATNDVEASHVTTGPDGEAVVPWAPGGVLGHVEVDFDDPA
551 WKVDEVERDHIREGLSVVRARRERVVQGRLVMPDGADARGILVTGFGFGP
601 KNNGARPFARARRDGTFRLSVPSDHGFILGIVDTAWACDAWTGVILGRDS
651 DRPADIVMKTYPATPVVVKVTRGPEHAPVAGAWIQVEGETPFRYIDAAGQ
701 QRDVRGGPGAWLTTDARGLARCGLGKGDVEIRISSGDWSESRTVRVTSAE
751 PVEVAFHRPWQGSRHVAGRLTLDDRPFVPSPSLVARAWARPVERRSIPKA
801 LTPKVHPDGSFEVEFDAPAATLFVLDPARGMSGYVAKAEADGDVPLHATG
851 SYAGTLLDDRGRPAAGRTLDLCVAETDFTPILSRTTDAEGRFRFDGAPSN
901 TPLWFLHRVEPGEPDLFLFDRERLLEPGEAREGETLRLQIPGTSAPRPAE
951 PLAKRIETACRNARVAPMRVLVVLTGADGDAVRAADAILDDEQTPDVLAF
1001 VPVRLDAEQVARDAEAIAAHGWPSPAAGEFVLVALDGEGKTVAAGPIDPK
1051 AADAGPAFLKRHRLPARDATSVLAAAREEAKRTGRRVWVVLDGPRCGPCF
1101 RLARWMEEHREALAKDYVVARIWAGVDARADEARAGLPVEPGDGVPWFAI
1151 TEPDGTVLATSRGPLGNVGFPSSVEGVRHLRAMIAKTAGRITPGEVESLM
1201 DSLRAR

>ECFp164293 ECF57 ECF57s1 Paludisphaera borealis

1 MIRTRQTTIGRDLERLLRDGVRPARGDAYLLDRYLGERDEAAFETLVERH
51 GPMVLSLCRRYLRDPRDVEDAFQATFLILVRKGPGLRDKSSLSSWLYGVA
101 YRVAVRSRSNLLKRRAREVQTDAILQAPARTTNPPDDSVETLDAELSRLP
151 EKYRAPMILCYLEGRTHEQAAAELGWPVGTVRSRMAKARAILARRLSRLG
201 LDAPASLALSRPDLLVETLSTTVPASLVQATSEVAGRFVGIAARGTGGAA
251 SVTSISTTWPATALAQGVLTAMLISQLKWIGLGTTALGLLAATAGMGAWA
301 VTPPSKLEGDPNPVQESKPAEAKPAPAQTLPGAQPQTRPQVVDVEARLAE
351 MDRKMDRLMERFERMMTPAAPQSPAAAAPPVEPAGTEAPPPASPRPRVRA
401 RGAEPSPAFPLNPRSDDERRNPSPTFKDPTDGGLREIEARLMNALNRHTL
451 TKALFERGQLSQLENFAPLEESRVLIARLKGIEDQLTGELEFVETIESPS
501 VGAEVLEAQSRQQDARLAVERYQALAKQHSTFKPALADAEMGLRVASFEL
551 FVKKKELERCKLQEGLLRTRLKQAQRILDWAKSHFKELGSLDGPAFDQPA
601 PGVPIVAPPPPSAR

>ECFp100744 ECF57 ECF57s1 Planctomyces sp. SH-PL62

1 MAGGGRPTIEGEIRKLWAFGTLGGADDRALLSRFALDRDEPAEEAFRILV
51 ERHGPMVLRVCRQILDDRQDAEDAAQVVFLVLARKASSIRVGGSLAPWLH
101 GAARRIASKSRGRAVSRRRIEERAAAAAEGRIVAREDRPPADDWEAVHEE
151 VARLPEKYRAPVVHCYLQGLTYEEAARRIGCPIGTVRVRLSRARERLRAR
201 LARRGFGPAQAALIGRLASAEAPPLARVGWSAATIKAVDALRRGRPAMLE
251 VVPSSVVSSYEGMVRAMVFDGCKTAGWILAAAMMTTAGAVGFSANGRGGQ
301 EAPVSRPPSGEVGKPPAAHQHGDPAPPEKPRDRTARERMVDAARERLEAQ
351 LAYYKEGRITIDRLIDASGLMMEAESTASPDKRLASVEAHAARMGELEEF
401 VESEDKLGRSAMGDLTKARLARRLASLWLKDVRSRPDAGEVEVLRRRVEA
451 LEERLDALLRQRDEAQPGDPG

>ECFp182406 ECF57 ECF57s1 Singulisphaera sp. GP187

1 MCRIRDERAVKVGRHILVSRYSGVILGQLDRVFNRGTVTGLDDDELLKQF
51 VVERDEVAFAALVARHGRMVLGVCRRILHDEHDVEDAFQATFLVLVSRAK
101 AIRDAGLLGHWIYGVAHRVAVRARANAARRHVHEQNSTAAQAGVEPPYCE
151 GERRELRAVLDEELARLPELLRAPMVLCYLEGLTHEEAAGQLRWPVGTVR
201 SRLARARDKLRRRLSSRGLTSDDATLTATVASQPVSSLLIDATVRLSLGF
251 TARQAMAPALASATATALAKGVLHAMMISKLKSIGAATLACVLALGGMQT
301 YAFQFGGAGGGLGPAAPGPQADDRQQALFRSVAKIQGDLAESARLNAELQ
351 KELTDLRAEVESLRQPAGLPAPSKASRPASMPPATQNTGGPAGGFGGGMG
401 RVGANERPRYIQTSKLIVVSSPEGDTVTAYSTETGKAKSLRLTKARDTKL
451 TVKPILSPELATLFLKGPKIARIAAFSVLDGTWYPQDLREPVDLAVPTVG
501 LTMAAYGIGRRIYAFSPVAKRWDVLELPEGAVAKPAIGNDAITCLHNGHL
551 YVFSVKTGKWEDIDTRAAPDDDQDGESAAK

>ECFp182409 ECF57 ECF57s1 Singulisphaera sp. GP187

1 MANGQSQAVPKQSRKVLDAGMSDGQLLGQFNTHRNESAELAFATLVRRHG
51 PMVLRVCHQILGDRHDAEDAFQATFLVLARRASSIRQPELLGNWLYGVAL
101 RTAWEARMSTGRRQRREATTAIIADQEPSDDAYRPEMALISREEFEVLHE
151 EVSRLPERYRIPVVLCELEGMTYQEAAHRMACPVGTIGVRLSRARERLRL
201 RMIRRGILPTAALSSALLGAEGASALVTTVLVNATVRGAAGFAASDAAAT
251 GFVPASVVALADAVLKTMAATRLKVATNLVLAVGITATVGWVGIHQPPWG
301 APRTERNLLQTNSPPAPAENRAAATAIGRAPLDVSAEGSSPVAPPIPTGF
351 PVSRPPGNGSIVKFANGAAAIPASPVISTRVGRHFNEEQMRGELLFTKEW
401 AVNDDRSRSGDGLGPVYNETSCVACHGLGAPGGAGAENKNVVLLTAISST
451 GGSVPKGLDRIHPGFRGTRSTVLHRFGTDPTYGAWRRRFSESSRAQGTPP
501 PEVDGDESVEVRIKRLAEQTDLNRRLRTHSARLQPEPGITLVVSERNSPA
551 LFGAGQIDAVPSVVMIDEAKRQPSDIRGRVSRDPKGRIGRFGWKAQISSL
601 HEFVRGACASELGLEVAGHSQGISPLGPDVKPSGLDLIEPECDALVAYVR
651 ALPAPVVVDPTGPHGTIAMSEGRRLFAEIGCASCHTPSLGNVRGIYSDLL
701 LHDMGTSLSDSGSYYWIDGSESIGGPRPGEWRTPPLWGLRDSGPYLHDGR
751 AQTLEEAIALHGGQGTKAARQYFSLPSQEQSNVEAFLKSLLAPSAASAAG
801 VMLAAELESRIVPDEVRDAEALVRKEREEAADREERQQSEDRRRRLVAAA
851 AKRAQQKLPIALNLERSGKIPGALKYYREIALEAPDTEEGRSAVARISVL
901 APSR

>ECFp182415 ECF57 ECF57s1 Planctomycetales bacterium 71-10

1 MTGVKGPQGHGYATAVERLLDDGSAVGLPDAELLDRFVGRRDEAAFAALV
51 DRHGPMVLGVCRRLIRDPHDADDAFQAVFLILARKAGGIGRKELVGNWLY
101 GVSRRVATRARVLAARRAKSDGLFDPDARRVPGPADSLAHDELGARLHEE
151 VGRLPERYRAPVVACYFEGKSCEEAAALLRCPVGTVKGRLARARDLLRRR
201 LERRGVTAPAAALATALAAPDLRAAISPVLVAQAARAGLVASSPSAWLTA
251 AVASSASRSLAEGVIRAMFYSKLRSLALPAGLVVAGLLAAGAGLAAPQQG
301 APNPPAETPKASEEASQATASPPQAAPPGRPSPPRSGVPGVMGGGGMGVG
351 GGMMGGGGRSPNVEVPSMGPISAPLAIARHAAFLEAEVGGGEANAPIYEA
401 LDRKVSFRLGEDATLTDFLKGVRAVEVAGGKRLPVFVSRSGLAEAEAAMD
451 RPVELELDDVPLKAALRLVLKDLGLAYCVRDGVVIISSFEEIRIELNEAI
501 FELLGRSPGTYELGPQGSVIKFE

>ECFp182440 ECF57 ECF57s1 Paludisphaera borealis

1 MTQVSGSRQGDYHQAIERLFHEGTVSGLSEVQLLERFAARRDEAAFEALV
51 ERHGPMVLGVCRRFLRDPNDVDDAFQAVFLVLVRRAGDIRRKDLLGNWLY
101 GVACRVAVRARSMAVRRPATTISETDGDQIAVDLRRPTSREADESRSWLH
151 EEVERLPRRYRQPVVACYFEGRTHEEAATLLGCPLGTVKGRLSRARDLLR
201 KRLERRGLAVPAVALAAQLASPDLRAAVPVPLASATVRSGLALATGSAVM
251 TTSAISLSVRTLTEGVLHAMVVTHIKAVALPMIVVAAGVLAAGASVAARQ
301 NADGKPVPKAAVAQTAPGAEKPTEKATETAPESEALTVADRDFTHRLEAQ
351 GRAYRGLQERLQSDLSGVRTDAAKDKARILYRARVEAMIRNIEKEEPASK
401 AGRDLKTAFLGFLNKGLDTKVAERDPNRGFGAPPVFPGFQEIGQSYIVSL
451 NKLLGDLAALRAPDEQAMARDLHRERLAALAESTSEPGSPQRDLYRAYLA
501 FRQQVDDNPQTLQFVASERPPTATKKAKAEPPKSAAPANTQQAEQAPAPK
551 VAQGGGFGGGGIGGPTPEEIRQEVAGLSATLAKFDENPKNKAMLEALDQP
601 ITLRTTEKSTLGDVLKQIKNSARVADGKKLPVYVDPIGIEEAGASLSSPV
651 AIDLEDVPLRFSLRLTLKQLGLAYCVRDGVLIISSLEGVQQELKEAESEL
701 MSLHPDKVLYGPNGRRWYTDGMGVMGGMGGGMR

>ECFp182453 ECF57 ECF57s1 Singulisphaera sp. GP187

1 MSAGSFFFMDSESAVLAGTHSQYFRERREKKCSSHASQRHYLAKAHSTGA
51 GEEVRMPAKLTSGIARDLETLFETGLSGDWTDGQLLEQFRSGPGPTAEAA
101 FAALIRRHGPMVLRVCRGVLNDEHDAQDAFQATFLVLVRKAGSIRNRLSV
151 ASWLYGVAHRVASRAKVDLARRRTHERRAAALIKESQNDLASGVRAEQAV
201 LDEEVHRLPEKYRALLVLCYLEGLTQDQAAASLGWPSGTVRGRLFRAREL
251 LRSRLSRRGFVLPAGVMTAGIAPREDAVAPAILFGSTSRAILLAASGNST
301 APGAVSESVVALAGATLKAMSVAGIKSALVLFGLGLATASIAGLAVQFGP
351 SPRLPIPVRLEKPAIAVAPVPTPVVVPTPRPVPLVIARPESKTPPSAPGA
401 VSPVIANRGSVAVGYPLENIEIDGGLADWPKDRIRYPVQKLFEGTGFADL
451 GGADLATSPDLSPSFSVGYNLRQQLIYLAVVVRDDKLVIGHTSHMDTDAV
501 EVYIDGLRSERRVSSTVSNPFWDSVGLSDLPVQQYIAIPGPGKIYGTKYD
551 TNPIVMAGDVKKTRTKMAFRRVGDVTTYEWAIQPFDRYPDQPTHLEVGKR
601 IGFDLAVADKDVPATSHQGMNEPPADRLVWAYWGPWWTGIKVFNAGNLGE
651 LILAAPR

>ECFp182456 ECF57 ECF57s1 Planctomycetales bacterium 71-10

1 MLRTSTTHDDYARSVERLLEGGSAVGLSEAQLVERFAGRRDEAAFAALVD
51 RHGPMVLGVCRRFLRDPNDADDAFQAVFLVLARKAGGLRRKELVANWLHG
101 VARRVASEARRRPRPATPGDASAFDADARRPAPPDPSDAAARDEDGRRLH
151 EEVGRLPERYRAPVVVCYFEGRTHEEAAALLNWPVGTVKGRLARARDLLR
201 ARLERRGVTAPAALLATALAAPDLRAAVPPALASRAVAAALAVAASPSAW
251 MTSAALSTTARSLSEGAIQAMFYAQLKAIAIPAALAAGLLAAGAGLAAAG
301 RQAPQEPGEPAPAPAVAKVADPPTPTETPPPESPAAPERPASRSVSDALV
351 EVWQIADNCRKSYEAAIQSSQPVKAEEQAAAMSRHRDRVGRLGKAVRDRA
401 AGDPLLLSLADYLDFRSKSPAKGPGGAAVPDLAIDMIARVPGNLQALLQS
451 AGLASLRLGGHSASTNTVDLIAKAWRDLGFDPSEFDRQLLQEKLVMIQHR
501 VLEESLLQAEREPEASDLLTRHAEYVRKLLAEAPPPPQTPKLVAAATTSP
551 STGADPAATPAVPDEAPPTFARADLSLSPEEVLDLIDGTGKAVVQRMKES
601 DVDLAGASTTQEAIEVVDHLCDEVDEHVRRLRSAKVAEPNGRALLDAFAD
651 SLARLLQTRGGKAGPGVGPVQDAEALDEPYLVFRRSVNRARLQAAGGPQA
701 REAAGRRHRSTIAPILKALREPTQQPITKPLLAAYADYLEAIDPFAEAPG
751 FRRVSADAPPSEPPAAQDRPAARGVEAVLKDVWKVVDQYQKSYQVAIQSH
801 QPGKPEQMDEALARHRERVGRLEKDVRARVGADPLLQSLADYLVVASKPS
851 TGPLESNVGPIMTFSVLGLVRSNLQEILKRAREGMGPELDPFDRELVRDT
901 LAGARDRLLAGSYNQAERDPEARDLLTRHADYVAKLLSIDSYVFPTKPAP
951 APGLAVAPPAAEAPSREPANPAASLPSTSSPSPSGGGFGGSGGPSPGEMR
1001 QKVAGLAATLAIVDDEPSNRKVHDALDRPSALKAEGKSTLGEVIEQVKKV
1051 LKAEDGSPIPVYVDPKGLEDADAALDSPVSIDLEGVPLKFSLRLALKQLG
1101 LAYCVRDGVLIISSLEGIEQELLEAQRELMSTHPGSFILQPDGTTLPAAG
1151 MGRPGGMM

>ECFp182466 ECF57 ECF57s1 Paludisphaera borealis

1 MNPSSSTVLKHLTTLFQVGTTAGQTDGFLLDRFRSGPADEAEAAFAVLVE
51 RHGPMVFQVCRRILGDRHDAEDAAQAVFLVLARQARSIRRTDSVASWLYG
101 VAARVAARARLDAARRRLLERRGAETATAIRDAVQRDGDGLETWPELCQE
151 LDRLPERFRLPILLCHLEGLTYEQAAQQIGCPVRTVQSRLARARERLRDR
201 LTRRGLGAGPAVASLAAVLNPDAASAVVSESWKHLTVQAATRYAASGVSA
251 AMVPATVAALAEGASRAMHLHRLMRWTAALLLIGVAVSGAGVGMLARSAP
301 PEPGRRIDPAPNDDRYRASFKNGATIEVVGVSTVPTGPNTWWKPDGSPLA
351 EAPIDAIERLAGGRHQNGEARVVLLRVSGVKKVDMFRWHPTPTASYWGGR
401 PRKNGQDIPDLQYYEAVFRDRTDCEVEARLADGAWKTEVANDGKGGVGTF
451 VNGHKFSFGRARPYEAHGRSMTVFSVAHNFFEQDRRIVAVDRDGKQHAAV
501 SYSSGSDGDKKWVIDLIDAEFPLPPDQIREYQVQFRPLEEVEIKDVALNP
551 RSADPGAAR

>ECFp182458 ECF57 ECF57s1 Singulisphaera sp. GP187

1 MTPGDLDLRLREQIRTLFEVGSLGALSDRQLLDRFSSGDTAASEPAFAML
51 VERHGPLVLAVCRRLLADPHLAEDAFQATFLVLARRAGSVRNRDALGGWL
101 HRVARRVALRLRIRIDRRKSHERPEVEEVAVNDADRLQHDELRAVIDAEI
151 DRLGEAQRLPVVLCCLQGLSHEEAAHQLDWPLGSVKSRLARGRRRLQDRL
201 LRRGFAPAVAAVAGSTAFLGNEATAAVAPALVEATARAATALAIRGLVTG
251 VVPATALVLVREELVSMIAFKLKLAAAVSLTAGSFALLIGFALAASQGEE
301 ASPKIAPAKQAAETPSANKADASPVVVKLSASGKVVDSGGKPIAGATVIL
351 REWSLYRAREPRSKEDRTFMEREGLVDSLAETKTDDEGRFRFDDVAAPGF
401 KKTEGVGQSVFPWDVVALAPGHGLNWVQLTLQNQQAPITLTLGLEGTVRG
451 RIVEPGGKPVVDAKVSVYGLQPLGSPDINGVRTDNGLNLSWSAFPVGAKT
501 DSEGRFIIRGLPIERIAALAVTEPRHERLFAFAATTDEPQPNHIQRSFRS
551 FGRVTESRHPIHTGGFTLTAKTTDHVLTGRVTLETGGKPARDARLTCNNQ
601 ATKADSAGRFHIEGLTSGPLELQVTSADVDAAPIVTTIAIPEEPKVLERS
651 LSLPPGLVLTGRVLDGASGKGIANALLTFIPMPEAARTSLDFDPQNETDA
701 EGRYRLVVPAGLGTLLLQTIPQGFAKPVGDRFDGPADPKFSREISGRSGQ
751 TIEVAEFSLIRSRNIVLRVVDPDGRPVENARVDVRDFNRQPEQPSGKTDT
801 QGRYEVTGLQPHEGTVIDVTASDRRLGAMIELLDDETATTAATSLEVRLQ
851 PLGTLSGHVLDDDGKPLAVQVLYLYRSVAFPDQSGRSFGRIVATQHQIDE
901 DGSYSFDQIIAGASYNTHVEVSGHATSSGKHATVKPGQSVRLDDFRLPVT
951 DQEVKGVVVDPRGNPLDKVMVSYDRSNRTDAIMPPTGSVWFEKTKSFGRF
1001 HLTGLPRGPIKLSVSRSQEGADRSIRNIKSIDVADDQHELLRIELPDAND
1051 HLRGID

>ECFp26113 ECF57 ECF57s1 Planctomycetaceae bacterium SCGC AG-212-F19

1 MTDGQLLDQFVRLHDAAAFEMLVRRHGPMVMRVCQRLLRHVPDADDAFQA
51 TFIVLVRKAHSIIKLESVASWLYGVAYRIALRAKVRANRRLARERHIDQG
101 SVPENAQASHEPGATDIRPVLDEELNRLPEKYRAPVVLCYLEGKTNEEAA
151 QQLHCPTGTVKIRLLRARDMLRDRLGRRGLGLTAGAIALALAQEAASAAV
201 PATLSAATAQTAALVAGGKASAVAASGATALADATIKAMMIVKVKAACAI
251 AVAASLLTAGAAYVGAGRTHDGSPLQLHATLEHTDGVFAAAFAPDGQTIV
301 TGGGDRIIRIWDAATAQELAKLTGHRHPIQSLAISPDGALLASGEGDLGG
351 PSGDVKIWDLPRRRELASLPPHSQGAPSLAFAPNGKVLATASWRGVINLW
401 DVASRESLAVLRTHTSGVARICFSPDGMLLASASNDRTVKLWETATGKEL
451 ATLRGHTDVVHAVAFAPDGKSVASGSADKSVRIWDVITHEAKLVLQPGSA
501 VHCVSFAPGSQVLLSGHTEKLNNSSEGVLKFWDVKGGALLDTVHVQKLQV
551 GNAIFSPDGKHLLTTSWNRTAKLWDVNTRSKAWGPSR

Name Aliases LCA Taxa Group Subgroup
ECFp26166
  • hypothetical protein
  • RNA polymerase sigma factor, sigma-70 family
  • ... more
Singulisphaera acidiphila DSM 18658 ECF57 ECF57s1

>ECFp26166 ECF57 ECF57s1 Singulisphaera acidiphila DSM 18658

1 MGRGGCETMTSGPSGALLMKQLRALCDGGVVGGLADGALLDRFLARRNTS
51 AEAAFGALVERHGAMVFRVCRAILRDSHDAEDASQAVFLVLARRAEAIRN
101 RDSVASWLFGVACRVAARAKVDAARRRERERRGAELAAQTVSENRGQSEA
151 CNRLYEELERLPEAYRAVIVLCDLEGLTHEQAAHQLRGSVRTVQRRLEQG
201 RQRLRRRLSPQITSLASGLPIAPEAISAACVETTARAAVRFVTNPGTLAA
251 GSVPASVVTLAEGVLKTMALNTLKLTAIACFSAGIVAGGLVTQVRSAAGP
301 PPAASPLRAEIDLGPRVVAALAPAEKEKEKAKETVRELTHDDGKPAGKKS
351 IAGSGHAVRFEAPGDGWLLTSIRLHGSRYGYPKPPNEDFTVYLCDENFQQ
401 IAAFPFPYSTFKRGPEDWVRMALKPTKVPAKFIVCVGFDPAATKGVYVSH
451 DGQKKKDGDNSSSFTGLPGDTSQPFTQGNWLIRVRLEPPKKADAAG

Name Aliases LCA Taxa Group Subgroup
ECFp26194
  • hypothetical protein
  • SINAC_RS37775
Singulisphaera acidiphila DSM 18658 ECF57 ECF57s1

>ECFp26194 ECF57 ECF57s1 Singulisphaera acidiphila DSM 18658

1 MESIGKGKNPQKTANEIEASTQYEGRTDGFVNLRGADTLVGSSGLKDLGR
51 LFSEGTDAGQSDGRLLERFVARRDEAAFSALVTRHGSLVLGVCRRLLRDP
101 NDVEDAFQAVFLVLVRRSGSLRDGDRLASWLYGVAYRVSLRARANAARRL
151 GRERPGIGVEALAIIPAPDRDQERRELLAVLDEEVTRLPEPSRAVVLLCD
201 LDGLTHEQAATRLECPVGTVKSRLSSARARLRSRLTRRGFAPALVGTGSG
251 LLVNQAVASPSEALVVRIVRAATPYLTGMTGVAEVGLVPATVAALVEGEL
301 AIMATISWKSLAGLLVVSGAVATGAVVSLAKPIPVSPPAAPRALQAPLDP
351 ARIPQPEPIPLALNAEPDSPLSLVNPGVEERAKNLPKGWSKGNPIRGVSY
401 IWSQDIAHDGNASLCLKKSENRYFPIAEWSQAVERTGDSPRLKVSAWIKA
451 DRAGKAILDAQFIDRDGKWSHAWIAYLGAKKSDDPPVTHDWKHYEGVVAI
501 PPGTTKIIIAPQIYGPGSVWFDDLAASYTTDPATDPLTQ

>ECFp182418 ECF57 ECF57s1 Singulisphaera sp. GP187

1 MAIGHRGAVLRQIERVFSLGTLSGMSEEQLLDHFTARHDEAAFEALIARH
51 GPMVWGLCRRLLHDPHDAEDAFQATFLVLLRKAGTLREPGQLSPWLYGVA
101 FRVASRVRSDPARRREKEGKVAKPEAVVSDLSREVDGLRSAIDEEVNRLP
151 EKYRRPVILCHLEGLTYEEAARQLQWTTGMVKGRLTQARERLRHRLTTRG
201 LAPSVGLAGPGIFPAAQVAVPQALAIRTAQVAAHIATAASASILALAEGA
251 IRTMLFTQLKAAALVLAAGTLTLVLSACAFALVQTDETPRAVATPLPEKA
301 VDPKPNPVGRSMEFRVVEPGTDRGIPGVQLTVRAGDLKTEASTDETGRYV
351 IQGIPPKVASAVTIWATKAGLVPKSISWWNDTANTRLPGTYTLSMESSTT
401 IGGLIRDEAGVPIEGAIVYIRADSGYGDGVPFTDVFEYPAKTDAQGRWRC
451 DLIPAGASDVSTRLVHPDYVSDQSYGDTPVPSPEQLSAQSAVMVMTRGAT
501 LSGTVTDAGGRPIPGADVKLGIDRFGAPQPPSTQTDAEGHYQFHVKPGSQ
551 VLTVQAKGHAPDLKRLPAVQGRERVDFQLLPAQPFFGRIVDRQGRPVAGA
601 RIVADTWRGCRTLNTKFTTDAEGYYRWDDAPADEVLIDIWKGGYMPIRKR
651 PMTASPEEVEIRLAPMLRVQGSVVDAESGQAVESFKVIPGYVIGDSQSPY
701 WLYSDLMSASGGKYEISLNDPRTPHVRIEAKGFQPAVSRPFRGDEGDTAY
751 DFKLQKAATITGIVRLPDGRPLPGAEVIMVLAGRSTMINNGRFTQRDRNP
801 WVETGPDGRFSLPAPEKDYSIAVLHDRGYGERSSQGLAADPVVTVRPWGR
851 IQGTYRIGSAPGVRQAIKADRRHSTGGTVVKIAFDYQVLSDGRGQFTLDH
901 VPPDEFLVSSVFQLPRDITTASGQSVIVAVQPGETRSVSLGGKGQPVVGR
951 IGIPKGSDRQVDWSYGSFAFETALERPIPPKGLDAQEQMRWWRESEESKA
1001 YSRAHHRFPLRIGPDGSFRVEDVPAAPYILSIQMYEPPSDHRRGGPAKVV
1051 GRAAHKFVVPEQPGGRSDEPLDLGEIPLNLNKRVGDPVSDF

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more