ECF proteins of ECF group ECF57

Displaying ECF 21 - 40 of 262 in total

>ECFp164437 ECF57 ECF57s4 Paludisphaera borealis

1 MQLRTNNDARLLDAFVDRSDPEAFAALVARHGPVVLRVCRTVLRDDHLAE
51 DAFQATFLTLFKKAGAIQDPESLKGWLCGVAYKTAARIRRRSIRLSEREQ
101 AWDENASGCEVVAESDHDLFLIVREELERLPDRYRAPLVLCYLEGLTHEQ
151 AASHLGWASGTVKVRLVRGRKLLRERLDRRKITLAAGLLLLWRCEAGAAP
201 PDGLVESTLGAVIEDAPLGLSHAEAAALSKPALFSIRFSIGDWAVICGAV
251 VLALFLGSTAATSAAAMIPWGPAAATDGADLPSNLTDVLAIDCS

Name Aliases LCA Taxa Group Subgroup
ECFp2587
  • hypothetical protein
  • GEMOB_RS52625
Gemmata obscuriglobus UQM 2246 ECF57 ECF57s4

>ECFp2587 ECF57 ECF57s4 Gemmata obscuriglobus UQM 2246

1 MVRQLSSLVHHLNWIVASDRLAQLADGELLERFTAEQDAAAFEALIWRHG
51 PMVRDVCRRVLGNDIDADDAFQATFLVLVRRAREVRSRESLAGWLYRVAH
101 RTSTRLGRETARRVARERRAARPEAVTTTNPDTCDWRAALDRDVERLPVV
151 YRDAFVLCHLEGRTQPDAARELGCPVGTLQSRLARAKERLRAGLTARGVT
201 LPAVSLGTVPAALVAATASAAAKLAEGAPTTAVAAAVALSQEVGNTMGLF
251 KAKLVLLALVTTAALGTAIGQVGPPAAPATTEVPMPVGATLEDLKKENER
301 LRREVEALKKKLAVAEARVLGDEPTDQEVIRALPKPAAGVVRDDIVIVKD
351 KILDRLDTVAPARLDSAIGPAQLRVQHWECRTYCTESVELPWPLPPKLTK
401 SRVYVAYVDRNVLVPVKGEQRPVQK

Name Aliases LCA Taxa Group Subgroup
ECFp2570
  • GEMOB_RS52710
  • WD-repeat protein
Gemmata obscuriglobus UQM 2246 ECF57 ECF57s4

>ECFp2570 ECF57 ECF57s4 Gemmata obscuriglobus UQM 2246

1 MTVPNRAVPPRLLNLLTADPVPDADLLSRFIQSRDGAAFATLVERHGPMV
51 LRVCRRTLWDAHTAEDAFQATFLALVRGAGRVRKTASVAAWLHGAAVRIS
101 LKARGAATRAHRTPPAPSPAQCGPDPLAEITGRELVSAIDEELARLPDRF
151 RAAITLCCLEGLSQDEAARRLGWSAASVRGRLERGRERLRVRLAQRGLAL
201 AAGLGGLLPGEAHATVPPRLLARVIELPTLGTVPPRVAEMAAGAAPSGAA
251 WKAVAVALVVLAVGGAAVGSGSPPQNTPETATASTMPLAPSGARPEGGAG
301 RPAANPPVKTDRYGDPLPAGAIMRLGTLRTRAPITGFGIEKDGTVVTVGP
351 GADVRRWHATDDRSDEPIALPLAGPANTNNEPQVSPDGKLVAACSRDKVF
401 VWEAPADAKAEPKPVATFDLARARLFRFAPDGRTLAVVTEAWNMVPAGAF
451 LCDLKTQTAAAIDTGGVRYFEGLAFSGDGKRLGAFADASCFILWDATTGK
501 QLTKYQAIGRMSRAFALNHTGDTRAAADYSGPKTEFRFTDPETGKKKDGL
551 TGPDGDIYWLTYAADGKTLLAGDPGGVRWWDPVAGKLVRRYEGVAHGHAL
601 QEVPARFTPDGKVLVSHNGHVLLRWNAETGKPLFPEQDIGHGATVTAVGL
651 SPDGTRIATRGMDNRLCVWDAATGKRLWHAPDARTKVADIDFGPDGTFLV
701 VGGPKWDEVTKYDAATGKVLLTFAVDPKGPKQAGVFSARVSKDGQTVVAH
751 TGPYVAGAPSVVTVWNAITGERLKSSPLSDSKWHEFSALSPDGEYLAGGM
801 LGSRAVAVAAPDRDLLADAKLPGSLTQTGRFSADGRWLALVTTERAGGAQ
851 KYSAVLVSATTWHAVSTIPLTADYRARIAVAPDGRTLAVAVGDAVEFYDA
901 GTQKLLGRHLAPPAGWEKFRFGNISALSFTPDGTKLITGHTDTTALVWPV
951 PARPGK

Name Aliases LCA Taxa Group Subgroup
ECFp26250
  • RNA polymerase sigma factor, sigma-70 family
  • DNA-directed RNA polymerase sigma-70 factor
  • ... more
Singulisphaera acidiphila DSM 18658 ECF57 ECF57s4

>ECFp26250 ECF57 ECF57s4 Singulisphaera acidiphila DSM 18658

1 MKGQDGTLLRSIRTLFGEGTTGSLTDAQLLGRFLSRRDEMAFEALVVRHG
51 PMVFDVCRNHLSNLPDAEDAFQATFLILATRARSIRQRESLGSWLFGVAR
101 RVASRAKLEARRRHTHERQAALNMAARVEGDEKRQDVSTLYEEVDNLPEK
151 YREAVVLCYLEELTHAAAAERLRCPVGTVSVRLMRAKERLKTRLARRGLR
201 IFAGIASKKSLAALPDSLVKSTADAALAASTTRGLAGVASASVAQMAAGA
251 LHALRWKAIGAWCVAAGLIALTSSACLALRTTAKEPESQETKREAEEESK
301 AKTNASEPWIKRLSDGTIVELVGVSSNPSGPETWWTPDGQPLAQAPYART
351 KARASADANQQAREFAVRVTTPAQVTATFDHNPAVLHVARRLEAARERVN
401 ALRRLIRNPNDPSFRYARKQVTELESQLEQLRRPTFPDLSSRNFAEREPE
451 ERWKILPVGSSVSGLPLDREGREIPNLKVIAMAMPKDQVTCQVSFGAPSS
501 RWKTVATSGPSGVSAQGIHGEKVIFGAAHESSGVTKITVSSNSSEADARV
551 VAMDDEDDKYPPIRIRALGTGGFQQLEVEFAIPLSQIKELRFQTRPFQWA
601 EFTNVALNPLEEHEVK

Name Aliases LCA Taxa Group Subgroup
ECFp2618
  • hypothetical protein
  • GEMOB_RS52380
Gemmata obscuriglobus UQM 2246 ECF57 ECF57s4

>ECFp2618 ECF57 ECF57s4 Gemmata obscuriglobus UQM 2246

1 MGRAVVGAGGGTDTDRELLRRFARDGDQTAFEALVRRHAGMVLGVCRRSL
51 PTVQDAEDACQATFVVLARRAAAVRWSESVASWLYTTARLVARNARVAAA
101 RRVEREARAAVPEVVEPVDRVTGREMLAALDAAIDRLPPAYREPLVLCYL
151 EGLTHDEAAARLGVPRGTVGTRVDRGRKRLHAALVRAGLAPTAGLLALAV
201 ANPASARLVGLALAAVAGPVPVAVAELANGIATTGTAKSLVCALVALACA
251 CALAAGLASVAPSRGGVARPTAAKGEPPVVAPSAARVEIKGRVVDANDKP
301 LPGAKLFLHLGHTIVPAQQVAAGDDGRFLFTISGDTLPLLLATAPGQGVG
351 RWPLNGRPVAEFTLRLTPDEPVRGRVVDPEGKPVAGVSVSARALYMYHGE
401 KDFDRWLKAARDPDCKEVARGGEPIYGTERGFTGPIEPATSDRDGRFELR
451 GIGRDRVVVLRASSPTTATHELTVVTRKVERFTARADTAITGSAEEVHGC
501 EPVVVAAPVPVTTGRVLDDATGEPVPGTVLRVGGLHGSSRLAELIAVAGR
551 DGTFVLPGLPPGGRPHAFVLPPGDTLYHALKVSVPDEPAGRAGFDIKLTR
601 GVPVTVKVVDKVTRAPVESQLRYGVFPGDNPNQKAVPNVRHFHQTEHPRR
651 PYISYESEFRIVAFPGKGMLAVQVPEVGAFGGAYLCGVGAGTFEKHRRGD
701 ELVGTTGVSRTSVRDWHTFAEIDVPADAKSFAVTLELDRGLTAPVRLIDA
751 DGRPVAGAESYGLVHPAGGARWSRPLADATPTAVALRAGEQRRVMFVHTD
801 RKLAGSAVVVGGAKDPVEVRMVPWGEVKGRIVNADGKPVDVRLDLSTDFV
851 RKPDLKFGSTPIWNPAIAGVYTGEDGCFRITGLVPGLTYRWGVNGWTVDA
901 ATSTDTVAKGGETIDLGEIVVRPEQP

>ECFp165197 ECF57 ECF57s4 Singulisphaera sp. GP187

1 MATRKDKTLRPQLLTLFNLGAIRELTDGQLLERFLTDRGEMAELAFAALV
51 ERHSAMVMRVCRARLSNPHDAQDAFQATFLILVKKARTLWVQDSLGPWLH
101 QVALRTATCARQDAARRQRLERQAAERAAPVDPQAPALDGERGAMLHDAI
151 DRLPERYRIPIILCDLEGRTCEEAARRMGRPVGTIKSWRARGRERLRERL
201 IQVGLAPSATLEATLAADLARGAVPKPEAETVRAATRIRGNAKTTGDVPA
251 SVCLLIKGVMKAMLLSKLRTTATILCALALFAAGLGTVARVAADDAKDKS
301 VEPLNKVPPLVSILMPDPTAPRPEEREIEVWELTLRDAIRIGLKGSDGLR
351 LVKAAHDGGPDASDEIVPLATDLDPSQFKTRVMRYVHSVTQQYWNLTQQH
401 VQLWSSEKAVELAREVKSREEAELELGRGTVADVAEIRQRLEQFQLDLIT
451 KKSDLIAAEQSLREHIGLPLADTRRIVPVTPPTEKKVPPDWKTSHATMLE
501 QQPDVAQTKAMVVKAEKQFLAGELEQINKAFAEAPGNPGEPAPAPDATRH
551 RLNRYHLIKKKAYLQQVIHQTTQSLSRFFLEVDANFKQYQTASRLRTAAT
601 QRLEAQRAFYEQGRITVDRYLDAISQYASAVAQEAQFKTTYNIGLTSLEE
651 AQGTLLEYEKLTVSQRPSEAKTPSTNKHDDATVPATHEHQALVTPMDRFI
701 GRRPHPTTTSTVPIASQSSTGEPASVSLSFEKTIAFGSKPITIQGSFTIK
751 PAPSTSSAPSKAP

Name Aliases LCA Taxa Group Subgroup
ECFp26136
  • RNA polymerase sigma factor, sigma-70 family
  • DNA-directed RNA polymerase sigma-70 factor
  • ... more
Singulisphaera acidiphila DSM 18658 ECF57 ECF57s1

>ECFp26136 ECF57 ECF57s1 Singulisphaera acidiphila DSM 18658

1 MGESTDGIVLKHLQTLYSVGAIGGLSDGQLGDRVHTGGDDTAEAAFTILA
51 ERHGPMVLRICRQMLSDRHEAEDAFQATFLVLARKAHAIRNRDSVAGWLH
101 GVARRVALRAKADAARRQIKERRAATLAVGRSPENNEGQSESWPELHEEI
151 ARLPERYREPVVLCYLEGLTTEAASQRLGCPKGTVLSRLSRAKERLRRSL
201 TRRGVVIPAGMLAVEWSSDIALAIPTTLLETTVRASLNFTARQAAGASLA
251 STTAVGLARGVLYAMTLSQWKTFGAATLACIFTLGGLQAFAQFGGIGVAD
301 EASTVKPAADDRQAALSQSVAKIQAELDEANRRNAELQKQLQAIQTELKT
351 LQTGPTSAPTKEAKPKGLADKAAEAAEPQGRDITNGSSPNFRHRRSDEFI
401 FMISRLGDKFKTFNTRTGRTSSLELPASKEFPLEITPLTDVQAAAFKLKG
451 QRITQLFASNSLEGPWFTQDLREPVNGTVSPIIRDHQISYHVGRYVYTFS
501 SIAKRWAILELPEGKQFRLDNSNPISFVGDDHIYTFDVFNGEWKDLNIKA
551 IFDAPDNKGPDDAKLPLPQTRLSPQSAPSLPNQLPSLDASGSRPAGP

>ECFp166900 ECF57 ECF57s1 Paludisphaera borealis

1 MAGGSPERLQRDLTTLFQVGTAAGLTDRELIARISRASADDAEALLEVLV
51 TRHGPMVLRVCRNVLNDPHDAEDAFQATFLVLVKQFRTIRKLDSIGSWLY
101 GVAARVSARARVEAAKRRKREREHVQLAVVPALDDEASRGLAIQEEVLRL
151 PDRYRSVVVLCYWESLTHEQAAARLACPIGTVRSRVARARELLRRRLVHR
201 GVADVDPAPAVLPLSSALVRSTVQAAAKVASGQSVSKVVAARVASLSLHV
251 IRRMVMTKLGMIAVPTCLALVASIGLGLAAQTAKRADRDDKPRADRGASE
301 TKKLQPAPEVKEYVVEPPDVILVEVLEALPGRPISGERLVRPDGKITLGF
351 YGEVYVAGLTIKEIKEKVVLHLRRFLGDEVLGLDVEGKKTPPGDTDRVFV
401 DVTTWNSKVYYVQGEVHDPGRLPVTGKETILDAVDFAGGLTPQADHESVV
451 LVRNDPKGGPPEKLHVDIDEVLLGDDASTNYYLQAGDRLVVRRDPGIQGD
501 HGDRPSAGRSKASSETKEADHPDVDTSNGPQRTPGLELKIQALERRLIAI
551 ESQLRKVLEKLDQPR

>ECFp167726 ECF57 ECF57s1 Paludisphaera borealis

1 MMTPVRSGVESGMKEQALGLESPGPPADRRLLEAFLERDEASAEGAFRRI
51 VERHAPAVLRVCRDVLGDHHEAQDAAQAVFLVLARKAASIRRREALGSWL
101 HGVSLRVARRARDAEARRRKAEKRNAEATSQRTERWSAAERPFHPELHEE
151 LSRLPERYRLPIVLCYFEGYTQEEAARVLGWPYGTVQTRLHRGRRRLREA
201 LARRDAAPCSLLAALLGPRQASPDAVRPEWVEETAWAAVRCAKYGGAGGS
251 VSPSVSHLAATIDSSLSISTTWVIGICLAAGGMWFAGRDVTEGSRNSRPP
301 VYSESPADGRIEERRAISLGGPTRRSSESTTADATPTNPIVARSRASATV
351 KPREVSATDEASAPILKAADRALSSLRAALAADGRELFERMWSPKDPRSH
401 GGDGLGPVFNARSCVDCHDQGGTGGAGPSSRNIDVATADVDPSTGMGFSY
451 AFSMNFGEGGFEYRFGYDPPAGARRTSQASLASAAIHPGFREARSVVLHR
501 FGTDPSYSAWRGAIPGRHGQIEVRMSQRNPTPLFGVGLIDEIPDEAIVAV
551 ARRRSPGSSQTRGRISRVAGGRIGRFGWKAQTATVEEFVLSAAAGELGLE
601 VPGRRQAGDPRLLDVVSAGLDMDRTECHALVAFVRGLPSPVVSAPSDPKE
651 AAMVKEGEKTFRSIGCASCHLPRLGGVEGIYSDLLLHDMGTELGDSSGYA
701 VFGSGPSRAAVDERGVDDRDGESETRAREWRTPPLWGLRDSAPYLHDGRA
751 ETVVQAVILHGGQGMSSADRFSRLSTRRKRQVEAFLMSLGAPRE

Name Aliases LCA Taxa Group Subgroup
ECFp26315
  • sigma-70 family RNA polymerase sigma factor
  • RNA polymerase sigma factor, sigma-70 family
  • ... more
Singulisphaera acidiphila DSM 18658 ECF57 ECF57s1

>ECFp26315 ECF57 ECF57s1 Singulisphaera acidiphila DSM 18658

1 MAQKQGRTIQAQIQTLFNEGVTAGLTDGQLLERFTTRRGPAAEQAFASLV
51 ERHGPMVLGACRKILRDDHQAEDAVQATFLVLAHKGGSLWVQDSLGPWLH
101 RVACRIAVRAKIAKNRSDDAERSVAESPRSHSDNKGPDLLGQALHEEIDR
151 LPAIYRVPVVLCGLEGRTYEEAARHLGCPVGTVKSRLARGRLRLRKHLAR
201 RGLDTPAGLLAVMPTPNSTKTTVPIVLADSLVQTAMRIATGTTTVGAVPT
251 SVATLTEGMMKMMSRSKLACCVGALVGVGILAVGMGVLVCRTAGAPPEVT
301 RGAGTARAAAPIVKNDDPTPKEPGQTGEIIARVANIAPDALGDGHTISMV
351 AIDPETAKWRTIAKDLPPGPVSPDGRFIVYQQLGLDLDEANSGIWVYDTT
401 GETPPRRIFERNGIPSWSHDGKQVVIGTPPAGPKFETWRVNADGSGRSKL
451 PIPETDLVFDCSRDGTWLATRTIGSDPVHWGRLTLVHPDGTGAQYLTEGS
501 AKKDVFNIFRISPDGQRIAYVEVKAENDIRKCRLFVMDLKDRSRREIPVA
551 FDPDTTANVCWSPDGSRLALNPMNNHTKEGAIVLVDLDGKNVRTVPLPPG
601 QWNLLVCDWKAMAPGLRVGDFNELSRAGADTPRGRFQALSEEVKKANPFE
651 PRRFVGRFLELAESAPEDRAAVDAWIWIVTFGSDGPECHRAIDRLADRHA
701 GMAKVANAALTLSFSTSLSAEKLLRAVIEKNPVRHKQGLAYLTWISHPIL
751 SGSDRSTISTARPRHPRPAWSPACSSRRRGPDRTSSRQREPGSSGPRAQA
801 GAHPDPHPSSGRGFPASFDWVSSFQHLGIKGPDRAKLVCTRRNTSAYGQP
851 LENFTHTLRTVTRTNAPIFKSFRRIVWHCASAIAVPASPSRRNASSNT

>ECFp165240 ECF57 ECF57s1 Paludisphaera borealis

1 MPLNRNHAAASALGDLLHTGSFTALSDGQLLERFATRAREAGEPAFAALV
51 ARHGPLVWRTCQAVLRDDHDARDAFQATFLVLVRRAGSLWVSESIGPWLH
101 RVAFRTAVHAKRDKNRRRAVERQAAERTPAWTVPSISDDLSLAIHQEVER
151 LPDRHRIPLVLCDLEGRSYEEAARHLGCPVGTVKSRLARGRAHLQDRLIR
201 RGITPSSAQQTLIMIGAPTSVSLPPALLESTVRAAAAFAVGPLQAACGLS
251 ALSITLAEGVLKVMLFSRLKMDAAVLATIIGLSTLGWLAHAAPDDSPRPA
301 PAPRNVEKNTSAPTVDLQGNWIVRGYPSGQAMSLIKIEGRRASARATLLA
351 ILMPEHYHFAESTIENFQIDDKAVRFTLKIAATRPIDARVLNVVAYLPKD
401 QAEPKVLRGSIDFSQQGQFPAILDRTDLKELDPKEALAAGNDELRRFNQT
451 KDREKQVEILKEMLKKYAEEPMAPVAGWALAITLADDKAPTAEVRAAVDR
501 AIEVAARYGPEMEVGTINLIVRNLVGAEDLEDLTLEYARKAEAMLRASYP
551 VALQENALQNLVNVLPKSRKIDEAAALAEIKTVEARLAKLGIPAAAETQR
601 KPGAVHWARNFAAARKEAAKAGKLVMVDFSTQTCGWCKRLDADVFPKPAV
651 VEAMRRFVPVKVDAEDGEGRPLVERYQAHIQGYPAILFLDPAIEDAHDGR
701 IVGKIPGYTPPLAFVELLNVIAGLPRDLPKLREQLKAHADDDETARRLAT
751 SLAMQGELMEAGELAGRPHGKETDPTVDSWASVYNTIGDELLIRQKPAEA
801 AEWYDKAGRTAKRPIDVYLARVGVGMTTAYQGKPEEAVKELEAAAGVVGV
851 SGDEREFAQTLLKSLKADVKTRPSTPK

>ECFp182391 ECF57 ECF57s1 Planctomycetales bacterium 71-10

1 MSGTIRGLLESGTALGATDGELLGRFVGRRDEAAFAALVERHGPMVLRAC
51 RSLLGDDHDALDAFQATFLVLARKGGSLWVRDSLGPWLHRVARRAANRAR
101 RDRDRRRAAERRAAEAAPSRSVALEPGRDDLAAAVQEEVDRLPERFRVAV
151 VLCELEGLTSAEAAATLGLPVGTVASRLSRGRDRLRDRLRRRGLDPKAGA
201 APVVLPAGLAEATASAAARFLPTTAAPPGVAAALAIGVLRAMSRNDVWRA
251 AALALALGASTSGVLALAARGGASEEPPPAAPPEKAAAKPEAAEVRPGVV
301 LMPVLVDGNVAATRREPVRLMLLPTSPFTVAIRSILPSGTRVKKGDVVVE
351 LDSGLLRKALVAQTAAASQARIRFQAADQACEIAKMALDEYKDGIYPAAK
401 AGAQGAVQAAESAVASSEKRAERVQRLREESARLLEKRGDAATPADVLAD
451 QEMEDRLDLARLGIQKDRLELEQARAKLAILEDYTRDKDLKMLQAEWNKA
501 QAERFSRVAEEEREKSQLVALERFIAKASIPAPVDGVVDISQLPGTGWPR
551 PGTHVQGGQVVAYIQQDDGRLVVNAEVPDETASRIRPGLRAKVTIAHLPA
601 RAGAVLDGVVESIEAQPSPSLQPTLGGPAPETNLAVIDLQDPPAGAKPVP
651 LRPGASVRVKFLIDSGPDALGVPRRGLVWYDGAYHVGVRKADGAVEWREV
701 VTGLYNDDVAEVRSGLEPGEAVVADPDPLLSDDQRRRVAIAPPPPPDLPP
751 ILWQESGGMGRGFE

>ECFp182443 ECF57 ECF57s1 Singulisphaera sp. GP187

1 MGESTDGIILKHLQTLYSVGAIGGLSDSELGERVVAGRDDTAEAAFTCLA
51 ERHGPMVLRVCRQMLHDRHEAEDAFQATFLVLASKAHAIRNQDSVAGWLH
101 GVARRVALRSKADATRRRIKERQAAIVAAAHSPEDNQGQSESWPELHEEI
151 ARLPERYREPVVLCYLEGLTTEAAAQRLGCPQGTILSRLSRAKERLRRSL
201 TRRGVAVPAGVLAAEWGSDVALAVPAALLETTVRASLNFTARQAAGAALA
251 STTAVGLARGVLYAMTLSQWKTFGAATLACVLAMGSLRAFAQFGGIGGTD
301 EAPAVKPVADDRQAALTRSVAKIQTELDEANRRNAELQKQLQAIQAELKT
351 LQANPTPASTKEAKPNQAATATPIRLPAEGFGMNAHTGFALQGGSNQYKH
401 HTFKNSVIVVSPLGDKIKIYNTRTNKTQSLQLSASKEFPLEVIPIASPGA
451 GALRLKGSNIIRIAASRSLDGKWITQDLREPVNGVVSPLGGTDIVVYLLG
501 RYAYGFSPKLQRWDVVELPNGTKGSPLAAIGMASIEGDGHVYTFDNDTGK
551 WSDVDLRAIIDAPDDNQPNDAEPNPAASESTPRATTP

>ECFp182452 ECF57 ECF57s1 Planctomycetales bacterium 71-10

1 MLRVASSAVIKQVAALFEAGTNAGLSDGRLLERFVTEGPEEAEASFASLV
51 ERHGPMVMHVCRRVLRNGHDAEDAAQATFLVLARRARSIRRMDSIASWLY
101 GVAWRVAARTRREADRRRARERRSVEASMTLRRTGGDDPEAYRELYDALD
151 RIPERFRLPILLCHLEGLTYEQAAERLGCPVRTVQSRLARGRKRLHDRLS
201 RQGVGPAVAPLAGILNRDASSAFASESWGRATVQAAVGYATGGAHAATVS
251 ATVAAIAQGATRSMTIHRLTKWAAFASMLGLAGAAALPWLLFALGSSSNA
301 APPTQGKLSLRVLEEGGGTPVEGAEVGLRADKHTQNARTDAQGVCTLDVP
351 SPPPSYFNVSIKKQGFVPASVSWERRGERAASIPAEQTVALQKGTTIGGI
401 VQDDRGRPIGGATVFVLVPINERREPGVARPSIWDYEVKTDAEGRWRCDV
451 VPAKLDDVWLRLNHPDFAGDRMYGDTPKPTLEKLRDLSGVMVMKKGIAVS
501 GRVLAADGSPVAGAKVAQGADRFGSHYPETKSDDQGRFRFENVRPGEMIL
551 TVQAKGHGPDLKRLAVGKESVDVEFRLEPPHRIGGRVVDSRGGPVAGAFV
601 AADTWRGRRSLEFRVDTDEDGRFAWEDAPGDEVLFDLGKQGFMSVRQKTI
651 KASDEEVTITLLKPLKVGGSVVDDETGKPVEAFTVTPGIDWGNGRAPYWE
701 LQSARRQSSGRYEFEFGEPRHGHLVRIEADGYLPVNSPMFKDDQGEVAFD
751 ARLKKGEGPSGVVIGPGGKPVKGASVCLVTAGAGAYLTNARPPDRRDSPV
801 VETDDAGRFRFPAQQGKFAVVALHDLGYAMVKDAELAKSSDVKLEAWGRV
851 EGTVRIGSRPGAGESVRLSVRQEGRGDEPQPYFDYRTTADSGGRFAFERV
901 RPGKVDIAREVKLSDRMTGYSHSTPIEVGPGATVRGDLGGTGRPVVGRVV
951 APGGEKIDLTFGQNSLRAALPQPDVPKGLTNEEKAEWYEAWTKTPEGKAY
1001 AEGANRNFTVKVEGDGSFRVEDVPAGDYEVNIAINEPPVGNACGIGGDLL
1051 ASARRKFTIPAMEGGRSDEPLDVGTIELAMTKRVKVGDQAPGFEVAALGE
1101 GVVKLDDFRGKFVLLDFWATWCGPCAAETPHLKSAFEAYRDDDRFAMIGL
1151 SLDQDKEAPRKYVDGNALGWRQAFLGNFGEAKLPNEYGVRGIPSIWLIGP
1201 DGRVIAKDLRGDAIKEAVGKALSSAK

>ECFp182459 ECF57 ECF57s1 Singulisphaera sp. GP187

1 MASAQLGDALRQIHRLFGEGTSTGLADGQLLERFLDHRDESAFATLVERH
51 GPMVLDTCQAVLKDRHDAEDAFQAAFLILVRKAGSIRAGDSLGGWLHRVA
101 RRVAIEANAEAARRRTKERKAGAIAAATASPAAAWDDLRPALHTEVDRLP
151 EKYRMPIVLCDLQGLTRDEAASQLRWTEGMVRSRLAKARRLLRSRLTRRG
201 LAPATVLFGGSARGAVPETWVTATTQAASTAATNGLGTTSAATLVAAVLK
251 AMSLTKLKMVAATALTITALAAYGAIAIRDNRDESSVQKNEKNVRSPASV
301 PLAEVPPATPRPDQTGSIVFHGRVLDPDGRPREGARLYLFQKGRETSPRP
351 SPSVRAASDAAGRFRFEVPRAEFNSYFDAEPWSDVSVIAVADGLGLALGH
401 GPTGDEALTLRLVTDDVPIAGRLIDLQGRPVAGASVRVLAVKTPASDDLS
451 PWLDALKTRKSGFDVERDFLPGYWYRPEESPIVAPVVSDSDGRFRITGIG
501 RERLATLVIEGPTIESFVINAMTKGAETIRVPSYRSPGATADVTYVGNRF
551 EHVAGPSRPVEGTVRDKGTGRPLVGVTIQAEEELDGSSNPIDHVRTTTDE
601 QGRYRLTGLPKGREGKVLVLPGSGQPFLRSLETIGGQAGAESAQLDIELT
651 RGVRVTGRITDKRTGRPVKARVEYFVFADNPHLDEAPGFRWSHDLGGSLN
701 DDDGTFRIIALPGSGAIAAQALEDEYLLDLGTDNDGNGILDTHPYNAIPS
751 NFNAITLIAPAPGAESAAVDLVFDRGRNLSGTVLDPDGKPLPGALISGLH
801 EAQYWEHTPLKTDQFTMSSLRPGKPRFLQFIHAEKKLAGWLMVREDETPP
851 PVVRLAPWGVVTGRLVDDDGLPRTDLRLVFSWNHKKDLPHGRLQGNGSGT
901 SGRIVPDGNGRFLIEGLAPGLLYSLEVEGKRAKRIGWAVRDLIIKPGENR
951 DLGDVRAVPSSLEEPE

>ECFp182437 ECF57 ECF57s1 Singulisphaera sp. GP187

1 MGASSVGFEPGRSVNAELGTLFNQGVTAGLTDGQLLERFSMRRGEAAELA
51 FAALVERHGRFVLNTCQKILRDNHEAEDALQATFLVLAYKSDALWVEDSL
101 APWLHRVACRIAIRAKLTASRRKLAEQAAAQEASDRSASQGRDDLGAALH
151 EAIDRLPGHYRRPVVLCDLEGRTYEEAARHLGCPVGTVKSRLARGRQMLR
201 ERLVRPGFALPAGFPAREMAQVPMPARLSDSMVQAATRITAGKTAAGVVS
251 ASVVALTEGMLKMMFIARLTRGVGAAVAVSVAVLTIGMGVIAYRTTGAPP
301 EAGGPDRAVSAASPSGNDRGPTQKGKPRRGEIIAQVADENNQISMVALDP
351 VTAKWRAIAKNLPPGPISPDGRFIVYSQLGRDHDEAELGIWIYDTTGKLP
401 PRRIFEQNGQPHWSDNGQRVVIGVPIGQGGQKFETWRVNVDGSGRTRLPV
451 PETDLVLDCSRDGSWLAMRPKGGEPAHRGALRLVHPDGTGARILAEGSAQ
501 DDLYTIPRISPDGRSVAWVEVRTEGSKDEGYNFYQIAPDGRSINFTKVKT
551 GNQPRTCRLLVLDLEGGPRRVLPVTFEPGVMVSATWSPDGSGLALNLHDR
601 KTKRGSIAQVDRDGKNFRTLPLPPGHWNVVVCGWQTLAPELRVSDLDELT
651 APDANSPRGRYRALLEKVETATPRNPQFHVGRFLELAEAVPEDRVAVDAW
701 IWIVTNGFDGPAFWRAVDRLAEPEHVKTIKVGHAALSVSHSVSPAAEKLL
751 RAVLEKNDDHAVRGLACLALGQYLKNQAERLQGMADPEKAKEWERLFLEN
801 GSTKENIARFLANNPDNLMKEAEVVFERTAREFGEVPHARNENLGQAAGA
851 ELNEIRNLCVGKPAPEIEGEDADGTRIRLSDFRGKVTVISFWADWCRSCS
901 VMYKDENAIRARMQGRPFTLLGVNSDDDRGKLKELIKQEGLTWRSWWDGG
951 GNANTPGPIARRYNVHHWPTLYVLDHHGIIRHKYLGIPDPLKLNAAIDAL
1001 VKAAEGQADVP

>ECFp182413 ECF57 ECF57s1 Planctomycetales bacterium 71-10

1 MANDTGGAALRSIRELFEAGAIGGMTDGELLGRFAARGDDAEPAFAALVD
51 RYGPMVLRACRAVLGDPHEAEDAFQATFLILAIKAGSIRRRESLASWLHG
101 VAHNVAASARAASARRRRHEEHAGRDRPAAVAAAAPDDLTAAVHEELGRL
151 PERYRSALVLCHLDGLTQHQAAARLGWPVGTVQSRLARGREKLRGRLLRR
201 GLAPAAVATALATAPEPVQAAALAMSTARLALAVAGSRALASGAVPAAVR
251 GLMKKGMRTMLVHNSIATASAALALAAGLATAAYAYQAARPEAPAPPVAA
301 EPDDADGLLTATGFVRMPDGSPAAGAIIRAFDSDRGAREVAVADAEGRFR
351 VRDEFASACNLHAATLDGSSQVVKEISPDSARTVLAEPLELALRPTAACD
401 VTASAEGRPVERAEVVATGPGFQVRGRTGGDGLARLRLPAGSPLDRIVVW
451 HPSQGAWGDVRMRDRGPAPRTVAASLRPPLPHRVRVIDEKGRPVAGVRLA
501 ASFQVEGGVWIATNDVEASHVTTGPDGEAVVPWAPGGVLGHVEVDFDDPA
551 WKVDEVERDHIREGLSVVRARRERVVQGRLVMPDGADARGILVTGFGFGP
601 KNNGARPFARARRDGTFRLSVPSDHGFILGIVDTAWACDAWTGVILGRDS
651 DRPADIVMKTYPATPVVVKVTRGPEHAPVAGAWIQVEGETPFRYIDAAGQ
701 QRDVRGGPGAWLTTDARGLARCGLGKGDVEIRISSGDWSESRTVRVTSAE
751 PVEVAFHRPWQGSRHVAGRLTLDDRPFVPSPSLVARAWARPVERRSIPKA
801 LTPKVHPDGSFEVEFDAPAATLFVLDPARGMSGYVAKAEADGDVPLHATG
851 SYAGTLLDDRGRPAAGRTLDLCVAETDFTPILSRTTDAEGRFRFDGAPSN
901 TPLWFLHRVEPGEPDLFLFDRERLLEPGEAREGETLRLQIPGTSAPRPAE
951 PLAKRIETACRNARVAPMRVLVVLTGADGDAVRAADAILDDEQTPDVLAF
1001 VPVRLDAEQVARDAEAIAAHGWPSPAAGEFVLVALDGEGKTVAAGPIDPK
1051 AADAGPAFLKRHRLPARDATSVLAAAREEAKRTGRRVWVVLDGPRCGPCF
1101 RLARWMEEHREALAKDYVVARIWAGVDARADEARAGLPVEPGDGVPWFAI
1151 TEPDGTVLATSRGPLGNVGFPSSVEGVRHLRAMIAKTAGRITPGEVESLM
1201 DSLRAR

>ECFp164293 ECF57 ECF57s1 Paludisphaera borealis

1 MIRTRQTTIGRDLERLLRDGVRPARGDAYLLDRYLGERDEAAFETLVERH
51 GPMVLSLCRRYLRDPRDVEDAFQATFLILVRKGPGLRDKSSLSSWLYGVA
101 YRVAVRSRSNLLKRRAREVQTDAILQAPARTTNPPDDSVETLDAELSRLP
151 EKYRAPMILCYLEGRTHEQAAAELGWPVGTVRSRMAKARAILARRLSRLG
201 LDAPASLALSRPDLLVETLSTTVPASLVQATSEVAGRFVGIAARGTGGAA
251 SVTSISTTWPATALAQGVLTAMLISQLKWIGLGTTALGLLAATAGMGAWA
301 VTPPSKLEGDPNPVQESKPAEAKPAPAQTLPGAQPQTRPQVVDVEARLAE
351 MDRKMDRLMERFERMMTPAAPQSPAAAAPPVEPAGTEAPPPASPRPRVRA
401 RGAEPSPAFPLNPRSDDERRNPSPTFKDPTDGGLREIEARLMNALNRHTL
451 TKALFERGQLSQLENFAPLEESRVLIARLKGIEDQLTGELEFVETIESPS
501 VGAEVLEAQSRQQDARLAVERYQALAKQHSTFKPALADAEMGLRVASFEL
551 FVKKKELERCKLQEGLLRTRLKQAQRILDWAKSHFKELGSLDGPAFDQPA
601 PGVPIVAPPPPSAR

>ECFp100744 ECF57 ECF57s1 Planctomyces sp. SH-PL62

1 MAGGGRPTIEGEIRKLWAFGTLGGADDRALLSRFALDRDEPAEEAFRILV
51 ERHGPMVLRVCRQILDDRQDAEDAAQVVFLVLARKASSIRVGGSLAPWLH
101 GAARRIASKSRGRAVSRRRIEERAAAAAEGRIVAREDRPPADDWEAVHEE
151 VARLPEKYRAPVVHCYLQGLTYEEAARRIGCPIGTVRVRLSRARERLRAR
201 LARRGFGPAQAALIGRLASAEAPPLARVGWSAATIKAVDALRRGRPAMLE
251 VVPSSVVSSYEGMVRAMVFDGCKTAGWILAAAMMTTAGAVGFSANGRGGQ
301 EAPVSRPPSGEVGKPPAAHQHGDPAPPEKPRDRTARERMVDAARERLEAQ
351 LAYYKEGRITIDRLIDASGLMMEAESTASPDKRLASVEAHAARMGELEEF
401 VESEDKLGRSAMGDLTKARLARRLASLWLKDVRSRPDAGEVEVLRRRVEA
451 LEERLDALLRQRDEAQPGDPG

>ECFp182406 ECF57 ECF57s1 Singulisphaera sp. GP187

1 MCRIRDERAVKVGRHILVSRYSGVILGQLDRVFNRGTVTGLDDDELLKQF
51 VVERDEVAFAALVARHGRMVLGVCRRILHDEHDVEDAFQATFLVLVSRAK
101 AIRDAGLLGHWIYGVAHRVAVRARANAARRHVHEQNSTAAQAGVEPPYCE
151 GERRELRAVLDEELARLPELLRAPMVLCYLEGLTHEEAAGQLRWPVGTVR
201 SRLARARDKLRRRLSSRGLTSDDATLTATVASQPVSSLLIDATVRLSLGF
251 TARQAMAPALASATATALAKGVLHAMMISKLKSIGAATLACVLALGGMQT
301 YAFQFGGAGGGLGPAAPGPQADDRQQALFRSVAKIQGDLAESARLNAELQ
351 KELTDLRAEVESLRQPAGLPAPSKASRPASMPPATQNTGGPAGGFGGGMG
401 RVGANERPRYIQTSKLIVVSSPEGDTVTAYSTETGKAKSLRLTKARDTKL
451 TVKPILSPELATLFLKGPKIARIAAFSVLDGTWYPQDLREPVDLAVPTVG
501 LTMAAYGIGRRIYAFSPVAKRWDVLELPEGAVAKPAIGNDAITCLHNGHL
551 YVFSVKTGKWEDIDTRAAPDDDQDGESAAK

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more