ECF proteins of ECF group ECF57

Displaying ECF 1 - 20 of 262 in total
Name Aliases LCA Taxa Group Subgroup
ECFp2583
  • RNA polymerase sigma-H factor
  • GEMOB_RS50070
Gemmata obscuriglobus UQM 2246 ECF57 ECF57s2

>ECFp2583 ECF57 ECF57s2 Gemmata obscuriglobus UQM 2246

1 MPRSAVALARFALAHDTPNTDAQLLSAFIASRAENPFAELVRRHGSMVLA
51 VCRRVLSDPHDAEDAFQATFLVLARKAGSVRGANVAGWLYGVAVRTARGV
101 RLARDRRERRADPDRKRDHTSPAPAPGDALAVAEQAAIVDEELARLPELY
151 RVAVVLCELRGLSRREAATELGVPEGTVSSRLAAAKRKLASRLAARGVAP
201 SVALAVLTSGSMTVSAELTRATTGAVSGAAGGTAGAAAAVVLKAMLFDQL
251 RAGAVVGAVCLALACGGLAMTGSADAPPARGNATAPAPHPVDDSMARLIA
301 QLGSESFAEREAAEKALRAHGTKAEPALTAGLRSDDPEVRARCAVVLVGV
351 RKDALAALVKGFDPKVEPQPAHPIWKRFQAITGNTSASRELFARILKRPE
401 WVARLDAAEANPAAAARQYRDAVTEIGTRFQSNMAVFFRIPVWPADTAEE
451 AAYLLFLGSYPGTETAPPANDTRALFSTGEGRLHYAKGMSLGLRGLEIAP
501 GPEKRYDATAALPSGSDRVFWKLLAAWLPRRADTSVLYNSFDLAVVSRAA
551 DVLPAARLIAGDGKRSAGERCGALRAVAQFGAASDLPLFAELYGDDTPVV
601 FPPPPSRYSPGPRSRRLIASDHAVALALLLCDQDPFEYGFARAKGLFQRE
651 NRRPVIAGYGAEDFGFNDDPSRAAAHAKARAFLDEQKPKGPKKPPAPVAA
701 QLVEQLGSESFAEREAAEEKLKELGAPAKAAVLAGLKSDNPEIARRCAAV
751 LPVLRRADWQRAAAAFAANPDTFKHPVWTKLKAVTGAGPDARAIFAELLA
801 NERAFVGIVEAIENPNAAERLHRAAHARLAQDLKGWYAADAKRNAVTALT
851 QWSPERGTYPAMLLLGTFPGTEAVPAHRVRLDAPRDEHTAWHACWAGLGA
901 EQRPAPGALGRPPAALQRLFVAWLGARENPDAAVSGFSTLLMLDCREGAA
951 LAHAVAADAKRTERARGWALLYLAQGGTAADTAAAVAAFGDAREFASSRE
1001 RTLQMRDIATAVALKLNGEEPADWGFSVRRGAAALKSAGPHQLGFTSNFV
1051 RDPLLKAAQAKVAELTAPLRTAPAPRAKP

Name Aliases LCA Taxa Group Subgroup
ECFp2622
  • GEMOB_RS51975
  • WD-40 repeat
Gemmata obscuriglobus UQM 2246 ECF57 ECF57s2

>ECFp2622 ECF57 ECF57s2 Gemmata obscuriglobus UQM 2246

1 MSATAVRRVVSRLQPGGALTDAELVLAIGAPGTSREAAFAELVGRYGPMV
51 LGVCRRVLGDAHAAEDAFQAVFLVLARKAELVRPPGAVGGWLYGVAVRTA
101 RKAKVAAARRRRYEMAVITPANVDGRCVAGALDHTELRAVIDEELAALPE
151 THRAAIVLCDLQGKTRAEAACELGRAEGTVASWLARGRKALAVRLARRGV
201 ALPAAGLLAVAVPFVVSAELSSVAVGTLAGRGASPFVLALAESVMKSFAF
251 APKKLFAGACAVGALLAAVATAAAWPGRPPVPDLPATPPTAVAAPVPKPE
301 AGSNGFLDHDGRIHSVSYAPGGKAFVSVGGGRAVVWEAGTQKRRFSVPAE
351 FAAFSADGKSLFVLAEDEFRTLDAGTGKVQATKKRDKPEAIYRGTTAAFT
401 ADGSKWVEFDGNVHHLRGDFKGGAPALAGQRVSTRDEYKRIFGRGGAFSP
451 DGTRFAGIHWKHAPEDANGVLSVWDAVTGVRTGALALPNSEAPAFSFAWS
501 PDGTELAVGRYSVEVYDAKTLKLSRRFDAGWEEMTGRFSALAWSPDGKRL
551 AAGRRVERSTSPPGRTGGVITGDTANVQLLDARTGAELQWFDGFPDNLPV
601 MSLAFSPDGKRIVCGAGNFPDVIGFDPPAGAKTLRVLNVEEPSVRGMRGV
651 AFGPDGSRYIVFRDGIIEVFDAATGKPLYTAGGEAGCLLADNGLVVLEPR
701 LISLYDARGHRTAGRRPPNTKAKWEHAVFSPDGKRYALHFGQNVRVYDIA
751 TGAEAFWLEGQLEASGMSSGHQIAPTVQFTDDGKGLIVSRVKLTADGPLG
801 AGVWSATDGKRLDTFVPNGKEQMEWAVPAPSGGTVAISFGTRVEIWATGN
851 GAKNPVHRFASSWRVDSLAYSPDGTRIAVGSRKEVGGDGGKANRVRETVI
901 QVFNATTGKEQHRFAERAVGRDCAALHLAFAPNGNQLLAGFSAAVGPGGA
951 VKLYDVTPPAPAVAQDWAEVATLTDLKGNVNGVAVSPDGKLLAATDHMGM
1001 IAVWDAKTRKVLATVNRATKGAYGVAFSRDNKHLAVGSDTGVLGYELPGT
1051 KLAAWSENNVKFGRVSEVAFSPDGTRLAATDGYVTRVRSLAGKELWSFQS
1101 HPRPKGESVARRIAPAWSPDGKWLAVPSKGQDSGAWGVSLSPKGEGAPTR
1151 VLTGPKAPVTCVAWAPDGSFFVAGDEDGTVIAWDAKTDKEIWRRTFHGRD
1201 MPAGRVHALAVSPADGTVAAAVDMLSGMCPQRVVLLAPRDGEAVASGLWR
1251 MAPVTSVAWAPDGRSFVAGYGVSEFERLPAGGGAGAVVVWGRKP

>ECFp168064 ECF57 ECF57s2 Paludisphaera borealis

1 MDRLFRRGTVPSGDGALLDSFLTRGDESAFEALVGRHGPMVRGVCRRLLA
51 SPHDADDVFQATFLVLVRKGRRLRDPDRLGPWLHGVATREALKARAARRA
101 DRTIPDVPSREGGNAEWSDVMPIIDAELARLPAKHREVLVTCLLDGATAE
151 EASHRLACPVGTVKSRLARAREALRVRLTSRGVAPAVAVAALTSADAFAS
201 PVSSTLIRATLKAAASHAAESGVVSLITGVAPTMISKSTLSALVLIGVSV
251 VGLGAAAWIKPSLAQIQQPSSGARPQGAATAPGETEASRVQARNLKEILL
301 ASHGYAAANNCFPQPAIYGDGNQPLLSWRVAILPYLGQNELYQQFHLNET
351 WDSPHNKALINRMPAVFETPAAPAPKGQTRFRGFAGKGSVFDPEFTSDAG
401 QNAGAMGGGMGSMMGGGGQSEMMSSMMGGMMRGRMGGGTAAVKQGVDQRN
451 VDRAKQQEEARSRETDAPADDSNRQQQPPRGTDQRVPQPGASSVEPEAGG
501 GAAAMGSGMMGGMMGMEMGSASSAVVRRGVRIADITDGTSNTVFIAVARD
551 ATPWTKPNELPFVPDQDLPALDDGDPRGYVLGMCDGTVRLLKKDGPSLHR
601 VLTALITRSSGEVVSSDVYHHVGGPSGAASPLAARANPPAAEAPGSASME
651 ERMRTVEEKLDRLLEKLDAK

Name Aliases LCA Taxa Group Subgroup
ECFp96870
Gemmata sp. SH-PL17 ECF57 ECF57s2

>ECFp96870 ECF57 ECF57s2 Gemmata sp. SH-PL17

1 MVLGVCRRILTVGPDAEDAFQATFLFLALRVGEIRNTGSVASWLHGVARR
51 VALNARKSRSRRTKHEQFAASDRPTKFTAEPATAASLTELQVALDEELAR
101 VPEPFRGTFVLCCLEGRTRPEAAIELSCTEGTVSSRLARARQMLQDRLTR
151 RGIAPAVALTAGALFEVAVPPVLGASTIRIASLLATTGHGTDVIPPAVAA
201 LINGVTAMSVKKATILAGLVVVAALAAGGIGLSAGSFQDRGPSAPSERPA
251 LSKGESPGDNQKKAANLSEYALQEGAVLKLVRAPFPEERDRLYTKFEAAK
301 AFQPPPPSETRLMAVYTNRGTPVSANAFTDRRVPGTTENGKPLAAFLEYP
351 LRVDMANVLDRDHLLESVVLDADVVLQKNTAPDKLIPALRDELKAKCGID
401 LRLEFAEVENEVVRISGKHTLVSPAADPTRPHDDAAIVHFYAKAREEHAG
451 GFYTDTRQLSSQLAQFLGLPVIDESNLKSATVWVTIRHHLRYPITPKTRA
501 EDADPVQVLKNVADQTGLTLKLEKQKVRVLVVEKQKKPADPPKKLGRVPD
551 PEPNLQAELARWDTAFRHGSDEKFAELERTAGEWLKKYPGQDDRGHIYFQ
601 VVHVAAQSRIDTQIARVREYGQKVLEQSRDPVARGTVYSYLASAAEVDRT
651 LKTFEERRRLAADVLLTGFAEALAQELPAEAPELPAVNRIGRELENDPVE
701 AARIRTQQAVQMDARREAKFVRDLVQRRNTLVLQLRGLYRPTPNVHGRNE
751 EGPKELRKLAAAKLSASATEALLAEVMKPPAR

>ECFp26142 ECF57 ECF57s2 Planctomycetaceae bacterium SCGC AG-212-D15

1 MAIAPHNRVREHIQQMLEVQSDKYLTDGALLDRFAAEADQAAFAQLVRRH
51 GPLVLNVCRRVLTNLADADDAFQAAFLMLARKAASIRQRESVASWLFAVA
101 RRLALHARARMKRRSAQECQVTDMSQASVPSQSAEDELRSMLDQELARLP
151 EKYRAPLVLCYLEGRSRSEAARQLGWETGAVKIRLERGRNLLRSRLLRRG
201 FSLTAGVIVTLLEPPGSARVSAAMIHSTTQAATAYAAGAGLFTGLVSERA
251 LALVEGMRKAMLLTKLKVVTIILLTAGLLGTGAAALVHPFAAAQPPEAAL
301 AAGALADAKPADAAVSGDALPAGARAGLGTTRFLHESDVIQVLYTPDGTR
351 LVTLSHHGAVRLWDAATGTPIREFLKPTQWAGAINSGGRRPAANIALALS
401 PKGETLAIANGKDVTLWEVESGKHTRNWQPASPAVLLLFAPDGKELFGKA
451 VDTYIRRWDLEGKELQKYGEPSKNPWMGGGNRSGLTVSPDGKTVTTTILD
501 QQGFFLVKRWDVVTGKDLQAKNKGEQGAMAIFAGDGKTFAWANPFKGALS
551 VRDIESDKEIRSVDGSSLQFSPNSKTAALRGKNHALILYDLDNGRELHTL
601 IAGTNDGPVQGGGFGWGFAPAEASAFSADGKKLVSAAGNRVRQWEVTSGK
651 EIVVAEGHTGAVSRVALTADGKTALSRGADGTLRLWDAATGKQQQRTSLP
701 VKAFHSAFSADGKTLALSGDGDVSICDVGTGKVKKEWQAHDKPLVGLALT
751 ADGKFLATRSHDKTIRIWDVQSGKKIQQIADAAEAPNMNMAGAPVGAGLR
801 DMDLMRLAFSPRGDLLAALPPTQPAFAFNGMWAQQPVAKDYAIYLWDIES
851 GKAAGRFDEAKSAIVAHAYSPDGRSVATAHADNTITLWEVACGKPCGQFK
901 TGMAQPLTALVFAPNSKVLVGGGQDATVRFWEASSGKELAQRKGHLGAIL
951 GLAIAADGKTVVTASADSTGLVWDVPALALTKTVVAELDAKQVEAQWAEL
1001 AGADPAKAQQAIRLLSGSSKQAVTLLRDQLKPVAVPDEKDVAKWIADLES
1051 DDFAARKKAEDSLAQLGELVQTALRKALATTSFSLEARRRMERIMEQNLV
1101 SRLPGTRLRELRSLAVLEEIGTPDARELLTKLAGGAADARLTREASAARE
1151 RLSKQAP

Name Aliases LCA Taxa Group Subgroup
ECFp112031
  • sigma-70 family RNA polymerase sigma factor
  • RNA polymerase sigma factor, sigma-70 family
  • ... more
Singulisphaera acidiphila DSM 18658 ECF57 ECF57s2

>ECFp112031 ECF57 ECF57s2 Singulisphaera acidiphila DSM 18658

1 MIGVEQLPFRSGREKNCIYEAERGQYKSRIRNRRKVPSQKGHCVGRMLNQ
51 LSDANLLERFVTFREEDAFATLVQRHGPRVLGACRRILRNEHDAEEVSQA
101 TFLVLARKASDIPWRESVGAWLCAVAHRLSLNARAGVTRRSRRELSVAAL
151 APVGADLGYSSLPEECHPQADPFAEIARRELRRVLDEELSCLPEKYRAPM
201 VLCYLEGMTNEQAAEQLGWPSGSMSRRLERARTILRQRLASRGLMLGLFL
251 LLTVAVSLRALRIAPHHEEGKALVMVREAMAPFKTHQAGGEDLERLLAAI
301 GRSDESLVSLPDALVVGRRSALVANQIAAFDPGKDRVTWNVSAMGMRQSA
351 LAMTDAAERGDTADVVAAARQLNQRCIQCHVAFRH

>ECFp26220 ECF57 ECF57s2 Planctomycetaceae bacterium SCGC AG-212-F19

1 MGNFELRALLKQFCQDLDESRDRCLVDQQLLQAFTANRDQEAFAALVRRH
51 GPLVLGVCRRVLQAQHDAEDAFQATFLVLARKASSIRKQQAVASWLYGVA
101 YRLASKAKLQAARRRSHEREATPPSPSLASDPTWSELRTVLDEELMRLPE
151 KFRAPLLLCYLDGKTQDEAARQLDWSLGTFRRRLDQGRELLRQRLTRRGV
201 ALSAALFPALLAQQAVAGVPVPLITTTCQSALLFVSGQAAGTLAAPIVAL
251 AEGFMKSMLFAKLKIAAGLLLLIAVCGVSLGVWSQRSSGGDAPPVPDAAE
301 GQAEALDQAHPEKARADADQPTFPRRLFAISVNNYAFLDKVGFGAGERSV
351 DKLVKQFADRLSIPADQVVILSDAMPAGSAKPSLPELTAEELARLSDDEV
401 KRLLERTVTAPAPPTKAIIERNISRFLDSSGLQDRLILMFVGHAVEIDNQ
451 AYLVPLEGERDNKESLIPLKWVYERLGACKARQKVLLIDVCRHDPDAEEA
501 RGHPMPMGQQLDTLLANPPTGVQVLTACTAGQFSYELDNKRKAGVQGGIV
551 LNLLPQLQLKDVQQRPQDPLPMAALAKALVPRTRYLAQAFLDKEQTPRLN
601 GTEAQTQLAYDPKAPATPRFKLELTGNFASGIASRAQIESLFKEIAGIPP
651 IRPGGGVVAFEKDILPVLQAKCAKCHIEPDRKKGGLDLRTVASIKKGGQE
701 GPAIVPNDLKKSYLWEMVETNMMPPKGEPQVTAAEKATIRQWIMTGAKDN
751 KEAAFATDLPGLQYDVLPPFPAGLLRAYADDGKNTPLREKVREAIALLKN
801 PQHNEPFPVVFHRKFDPANQQQVNLFQNSLAQTQQEMGLRQFQLDTVLEE
851 LDILEKDRGKEGKRWQALFDFVRARLAARIAYMYEYNVKLGEMRKERPAF
901 DPTKHTGWELVPVAKITDRDAEKYAKRASAFLEQLATDHAATPWELLAKR
951 ERHNPLGLEWRAR

>ECFp166918 ECF57 ECF57s2 Singulisphaera sp. GP187

1 MGRMLNQLSDASLLERFVTSREEDAFATLVQRHGPRVLGACRRILRNEHD
51 AEEVSQATFLVLARKAADIPWRESVGSWLCAVAHRLSLNARAGVSRRTRH
101 EVPVAALASAGSDLGYSSLPEECHPQADPFAEIARRELRRVLDEELSCLP
151 EKYRAPMVLCYLEGLTNEEAAEQLGWPSGSMSRRLERARTILRQRLASRG
201 LWLGLLLLLTLTVSLKALRVASRDQGQALVMVREAMAPFKSHQDGGEDLE
251 RLLAAISRSDESLPSLDEALVVARRSTRVAERIENFDHGADRAKWNGYAV
301 GMRQSALAMTEAAERGDSSDVVAAARQLNQRCIQCHVAFRH

>ECFp182392 ECF57 ECF57s2 Planctomycetales bacterium 71-10

1 MGRTGDGTLRRIEALFRTGRTGSWSDGRLLASFADGRGVEREDAFAALVR
51 RHGPMVLATCRRMLGASPDADDAFQAVFLVLARKAGSLRDVDDVGGWLRV
101 VAVRTGREARARAARLRAREGAGLGDSHAAAGVDPDLFELRSALDEELER
151 LPGGFREAIRLCELEGLSRREAAERLGLAEGTLSSRLARGRSLLRDRLAR
201 RGLAVGLLGAALAPEPRAALADAAASLAVHTTRSGAAPGTVSEAVASLAE
251 GAFAMLVASRWKSLVASAGTLGVLALAAGLAWSQAAPAPDEPPPGALPKV
301 TPAAPSPVHVFVMEADGGLVAGAEVRLNPYTFDERIGTTGRDGRCVFQDP
351 PGLPDDRSVLVSVDGGRLVGAWRWRPFMDRGTRSAPVGIEVRPPREVEVR
401 VVDVHGEPVAGAEVEGVANRRVVAHAEAGADGRARLLIPAGETSLRWIAA
451 RRRGVGLGYAEFGDQDHRGTDIGVAASELPRSVEVSLAPQTPVQIRVVDE
501 AGAPVTAGRVVPGGGIYQPGHRHNLAYAGRLVGERIGPDGVARFDWYPRS
551 SPRADFGAVVPPRGVGSVEIGFGASDSYLLRVRRPATIRGRVTMPDGSPA
601 RDVMVQGLADAAVTAVDGSYEIAASPEPMQAVWVVDGEYAAPARMDVVPR
651 AEAPVEVDFRLAKGLPVRGVVTAGPDHHPEPGLTVWLVEEGVPIPEGVPK
701 EGAAGDSRKEATKVKRDEAYLVKKEAPGAAPQPRVRKTGRSVLATTDERG
751 RYTFRVAPGTYRIAVPTLRRAEIFEVRDETGVVRDFHKDRQESRLLAGRV
801 VDERGEPVAGARVEAMSTDGLSATRPLTTDGEGRFRADARPVSHWVTATS
851 DDGLLAGYIEAAADAEDFEVVMKPAARATGIVCDRSGEPRPRQMLLWERL
901 AEGRREDGEAWTFTIPGPSTFADDAGRFTSPPLVPGLEYRAELIPQSNRP
951 PDFADVALGPVRPTGPGPLDLGAMRVDDRPLEVQFRERREREREAK

>ECFp182432 ECF57 ECF57s2 Planctomycetales bacterium 71-10

1 MGERDRGAIVQGLERLLSRGVDPSRDGDLLARFRAEGDQAAFEALVMRHG
51 PMVRGVCRRLLRDDHDADDAFQATFLVLARKGAGLRDPDRLGPWLYGVAS
101 RVAAKARVRSARHQARPLTDDLPAREDARAEWSDVLPILDAELARLPSAQ
151 RDVLVACLLQGSSEQEAARAFACPVGTIKSRLSRAKEALRSRLVRRGIAP
201 ATALAAASSPGATASPVSAPLLRATLSLVAAPAAIPRSVAALTSGVAPTM
251 LSKILAPAAAVVGGLAVVGLSAVAWTADPPLIQKATQPASTPIAKVSPED
301 RARLDRNLRTILLALHNSMAAEGGFPRPAVLAPDGRPLLSWRVAILPYLD
351 EKELYDQFHLDEPWDGPHNRGLIARMPAVFQTPGLPAPAGETRIRGGDAP
401 GTIFGSRADTSAVGKIAFEDVTDGTSVTAALVVAQEAVAWTRPGEMAKLQ
451 REVGWIKDGKATTYIEDYWPLMDDGPDGYVLGMVDGSVRRLHPSLQRSLL
501 PALLSYAGGEPVNLSALAAPSIADAPVSTTESRKPADVEGRLRRVEEKLD
551 EILDRLDALAPSKP

>ECFp182430 ECF57 ECF57s2 Planctomycetales bacterium 71-10

1 MRNSGGSVARDLERLFRGGVDVADGELLRRFLAHGDGDAFEAIVIRHGPM
51 VRGVCGRLLRDPHDADDAFQATFLVLARDGRKLRDPGRLASWLYTAARRA
101 SLRARSRSARRRADPLPADVAAPEDRRGEWSDVLPILDAELARLPASQRD
151 VLTLCLLGGATEQEAARRLDCPVGTVKSRLSRGRDALRHRLVRRGVAPAV
201 ALAASSSTVSFASVVPETLIRAAVAAASAGGPIPPAVATLARGAFSMLAK
251 STILATALAAGLGLLGWSAAAWTLDDPAPQAPDAPAPAVATGNPSPGQLL
301 KDNRLKQIGLALHNYAAYASNDRAFPPQTVRGAAMSTGPAILSWRVAILP
351 YIDEEALYKEFHLDESWDGPHNRQLISRMPEIFQTPDAPALPGHTRFQAF
401 WGPGAIFKSQVKGEPGEPKSEGTRLSEITDGMSNTAMVGVAARPVVWTQP
451 DDLAFIPGQEPPSLDTSDARGYAILLADGSINFLPERPTRPNFLTALLTR
501 AGGEVLNWSDQSSLEVPPVRTLGDMSSSPPTPATILIAPASVEDRLRRLE
551 EKMDRLLQKLDADGDPKP

>ECFp26175 ECF57 ECF57s2 Planctomycetaceae bacterium SCGC AG-212-F19

1 MPGGQLNSVFRHICRLAGLSSVCDQTDSELLGRFSASRDEAAFEAMLQRH
51 GPLVLNVCRRVLGNPDDADDAFQATFLVLARKAGSIRQSESVASWLHGVA
101 YRIANKAKVHAARRRDHERQVADMPKLESGGLALWEEMRPLLDEELSRLP
151 QKYRVPIVLRYLQGKSNEEAAREMGCPAGTLSWRLSQALELLRQRLARRG
201 VTLPSAMLGMLLAENAASAAVTGTLNDTTLRAAVLFASGKALAAQGGALT
251 IITLAEGALRAMWLYQLKMVSLLLTVVVLLSGVGFFALRGLVTEAVAVPT
301 PERQTAREPEGGKAVNGLKLTLSADKTETVMKADGSNAEPVKLKLTFTNV
351 SDRAIKLRIPKDYDGFQYHYLKLDLTGPEVRSERVDRLAIPSGGAEDDFV
401 MIESKDSFSPGFDISFPAGPFKDLRYSLHQQGEYRLRLSYENAYPGKQKD
451 SWMGSVRSNELVLKVLPDFGPDVKGLRARVTLGKHKCVVGEAIVANYVKK
501 NVSAAELTIWHSVFWPNHQVRVKDAAGKEPPLTEAGAARRTAFAPGGGRD
551 KNAPWSLKPGQEDATEGNYDITNFYDLSKPGRYTLQYIYEEKQGGWEGRL
601 PSNEAAFEIVAVGKEVNGLKLTLSADSTETVMKADGSDAEPVTLKLTFTN
651 VSDKPIKLDAFLLGWYKFAYDVTGPTADSLELQKYSGPIPKFKPADATSY
701 PLLKPQESYTYEKGISTSFPGRLGEMTVYRVRKPGDYRIRFGYKNEQEAA
751 NQFAKGSWTGTLTSNELILKVLPAGGKEVEEKTKPSSKRTLDFFKKNLDK
801 ELTPAKAVEVFGEPDGKPGSGLNIYAYVLDDGSKVWLAFRGFEKIFYAKH
851 IKTGKTEDLPLK

Name Aliases LCA Taxa Group Subgroup
ECFp26138
  • RNA polymerase sigma-H factor
  • OSO_RS47955
Schlesneria paludicola DSM 18645 ECF57 ECF57s2

>ECFp26138 ECF57 ECF57s2 Schlesneria paludicola DSM 18645

1 MADGFRCRTELTRISRRQDPNAIFGSGHLFERDNLMNCTDQPAVAEVPIK
51 DSLVTDGELLKRFAEHRDQQAFADLVGQHGPMVFGVCRRILRNHHDAEDA
101 FQATFVVLARKASSIARPALLANWLYVVAHHVSTKAHAVVARRSVQVKPI
151 SDLPEPATVESESWIELAPVLDQELRRLAEKYRTPLILCDLEGLTRKEAA
201 RQLGWAEGTVSTRLMKARAVLEQRLTRQGYALPAGTLAVLLSQQSASAAV
251 PSSLAASTIAAASAISAGQAVPTGVISAKATELSRQMLTTLLLGKIKVAL
301 GIMVVVTAAATGVSKVVWMKAPVVAVAADGIPANIRAALEQNANAINPIG
351 IRYTTEIRSRLSQRETLEKLQIAADRVSPILFAKRPYRTIVEGQKFYSSG
401 TEESLPPRSNRLIVASEEGSFDGAVLYGGRKYKRLGDSMGGDLRMYGWER
451 QKKSHLSIPTHLRGPYFTGTPTYSGLSFSRKAGQQSELTAESDILRLLRM
501 KGKVQSVENVSLDGRSLVKIELIVENQTRDEAEWIDLRQLEGDDSEELAT
551 PDERRRTAEILRWQRKLPATKRVVYFLDPALNYAVRRREDWYDPHTLLIR
601 CDCSEFEKLSDHPVWLPHRCVSEIHELQTRLFYQWDHSRLLAPKRTYQFD
651 DSFLTEIVEVTELTTTPFPAEQFVLKYTEPGIYIEDHTLPAGDNRQFGGI
701 GYRTGQTPAETALNLARATEQQTNGKRAQRTRDESSQAAGGRGWTTWHWF
751 VVANISVLFLVTVIAGVRRFVLRKD

>ECFp26202 ECF57 ECF57s2 Planctomycetaceae bacterium SCGC AG-212-F19

1 MAALPFGTALRHVLHRIEPRPAGDHSDGALLARFTADGDETAFAALVARH
51 GPMVLGVCRRLLGDQHDAEDAFQATFLILARKAAALDGRQPLGSWLYTVA
101 RNLALKHRARGARRRMREQEAGTMPKTGPQDETAWREVCTVLDTELGRLP
151 EKYRAPLVLCHLQGMTHEAAARELGWPAGSMAKRLTRGQELLRQRLVGRG
201 ITLALPGLLALMAQKGSAAVPPPLAAGIGMAAPLFAGGKTTAGHVSVQAV
251 ALAGRALHSMTLTKLKIAAVGLLGLVTLGAGTAVCLRAGGNEASPLAAVD
301 PSPARPAAPAAEAREVPPAADAAVAEHLRRKLDQPVNLDKGIDANTPLKD
351 ALEFLSDRYDLTLVVDEKAFEARGVQKVAEQPVSLPKLVGVRLSSVFRLL
401 LGQIELDNGEVGGIRIKGDALHILPVVACEPDDRWLPHSWRRRLLRPVAW
451 DKDIAAGTPFAAVLEQLTKQSGTSFAFDEKAFKALAVTKPGEFKIAQTKL
501 AGQSVTLNYVLDSLMAELSNDQFSVHYRVQAEALAITAAKRDSAEERALW
551 NALAVLRERGDVLRQIAASAKKLEKVVTLRKEVDAETPLRDALEFFSDEF
601 DVTLVIDATAFAAIGIPKVEEERVQLPPQKEVQLGVLLRKLLEQVQHEDW
651 TAGYIVREEYIEITPVHKNVHGQQRLSKGQLQGLWDMLAEKHWQRPVLAS
701 QTLARFPEQAVALLRERLPPAPPADPKKAAEASRWVKDLASDRFPAREKA
751 AEELDKLGSAAVPALRAVLEAKPTLDLRTRVESLLAKLEVPMSRERAREL
801 WAVHLLEEIGTPEARAVLETLTKGARDAWTTDKAKAALERLNN

>ECFp26255 ECF57 ECF57s2 Planctomyces sp. SH-PL62

1 MMGRNSGKRGGMIGTVHGLQSLLEVGATGGLSDAQLLDRFVARREEAIFG
51 AIVDRHGPMVWGVCRRVLRDHHDAEDAFQATFLVLARRAGMVSPAERLGA
101 WLHGVAHRTALKARATRAKRLARETSVCAASEPWETPREARDALSESLDR
151 ALAGLPEKYRTPIVLCDLEGQSYAEAAERLGWPIGTLSGRLSRARSMLAK
201 RLARRGVAMTAGALVASLSREAASATLPATRLAPLLKAACLTGRTPWAAL
251 VSTEVVALSQEVHGGILMTRLKTTGLGLLTAGMLATGIGVLAQGQDGEPT
301 TQESPAPSPKSAPKRKAPPTTVTYFIGDLILDDPTKPPEVVTFADPTTPS
351 VSRPQVDMSPMIELITSTIEPEHWKEKDGSARDITPFFLSRSLIIRGEPE
401 VHERVGALLRGLRRFQDEQGTAFGTNGLHQPQTYDVSDLLLSHSDPADSG
451 GGPDAQALIKVITSTISPSRWVARGQGSPYVATGPREGELVVSHAKLGHE
501 QVSALLAGLRLFRHAKSAEPTPTPTPTPTPTPTK

>ECFp26261 ECF57 ECF57s2 Planctomycetaceae bacterium SCGC AG-212-F19

1 MASAPFGTVLRHIFQRMGTSPGADPTDDGLLARFTTDRDEAAFAELVRRH
51 GPMVLGVCKRILRDPNDADDAFQATFLVLARKATPLDGRRPLACWLFTVA
101 RNLALNHRLAAARRRAREKEARAMRSTEPGEQTAWDDMGEVLDAELGRLP
151 EKYRAPLILCHLQGLTHEAAARELGWPAGSLAKRLTRGLELLRERLVGRG
201 LALPAAGLAALIGEHASAAVSPSLVIQISRAASLYALGQATQGLVSTSAS
251 ALAEGALPALFFPRWKVAAAVLFAISVLGAGAAVLGHRSELPPVATPAVP
301 QDKRAAPPATADPRDQDVRRRLARVVVLERGIDPNTPLKDALEYLTKRFD
351 LEFRVDEKAFAAAGVEAVDERTVSLPRLAVPLGTILRLLLRQIDPDNGQV
401 SGYRIEQGVVVLAPAFYDTAEERFPRGLPQRLFQPVRCDREPYDQTLADA
451 LTAYGKLYGQKLVLDHKAFAEVGEPDPDRYPLAGRGRELAEEPCLLEILN
501 LILWQVDGPTWKSYLRVQDGALEITAAKHDSAQAKMLAAHREMIDEYWGM
551 WTGTPRGDVTLRQKVLLDKGIDPNTPLIDVLEFLSDRWDLTIVVDELAFA
601 GAGIENVREFPVQLEPQRTTIPLEKALRRILDQVKTDTYTAGFVCREGYF
651 EIIPEHNQLRQKKPLEARHLDQLWQDLAARSEGRSRLAVQTLAQAPREAL
701 PYLKVRLKPGGPPERDRGARARKLVAELDSDQFAVRERATEELEKWEYDA
751 IPVLRERLAEKPSLEVVRRIERILQKLGAQSPNPELARTLRSVRVLEAIG
801 TREAQQVLETLASGEPEGLPTRAARAALERIRP

>ECFp26270 ECF57 ECF57s2 Planctomycetaceae bacterium SCGC AG-212-F19

1 MPQGQLGSLLRHIRRLIGGAEGADAPDALLLRQFVEHGDEAAFTALVQRH
51 GPLVMGLCRRVLPDAHEAEDAFQAVFMILAKRAAAIRRPEALASWLYGVA
101 YRVAARARAGYRKRATRESQVTAMPGTDPSPDERVSREADPLSEANRREL
151 RGVIDEELNRLPEKYRLPMILCYLEGKSNEEAAQQLRWTKGTVSGQLARG
201 RDLLRHRLARRGVALSAGAVVAALGASAGLAAVTPALVETTVQGALLFNA
251 GKAVGTGAAAAATLAQTTLHGMFLAKVKVAAAVLAGVMVLGSAGGLVAYQ
301 SWQDHRHAGVAVASTTDQPQPTEPQARNFDPTRSDQVALVLRVKKQGDDR
351 QAQGRRWQEVVILEVLKNSPGHAVGHTMLVASTNHKHGLPAEECTIYLEP
401 IRPGDGHWQLLGGGAPEGISHPAAVRPPAHH

Name Aliases LCA Taxa Group Subgroup
ECFp26289
Gemmata sp. SH-PL17 ECF57 ECF57s2

>ECFp26289 ECF57 ECF57s2 Gemmata sp. SH-PL17

1 MSAARPAEILRQLEHPSAPDVELLTQFVLTKSAVAFEELVRRHGALVLGV
51 CRRVTRNPQDAEDAFQATFLVLAQKAVTLRSDVRLWSWLYGVAFRVSWRA
101 RRAALRRRVREVLVSKLPEPHAPRPSPERPELGPILDEELAALPECYREA
151 IILCDLRGASREEAATALGVPEGTLSSRLANGRKKLAARLTKRGIALSVS
201 VLPIAVAETQGATAVPIELLRKTCELVADYASSGTIPGPLAELTKRGLVV
251 RKTLVFGLVTVVAITGAVIAANPIAAPPADPPKPPATAKTEVVTLPQGEQ
301 KALPALATAPRIIAGWDLPITNPERVIWAPSGDRLAVAGAIRVQPDGNAW
351 FQPAFVLVKYTGKSDPENIVRTAMPRNGSVVGFTPDGKQLITDRRERHLL
401 SGLHQLVYWDPEKAEVSPVNSIPSLQNKAKLRTVSFDGAHVDGTYIFDSN
451 GKTFRAMTNEPGTGEAPKTLDVIEVDTATGKAGKPLATIPRVPCALSPNG
501 KRLAFMAPNKSSVRVYDLDNRDKPELSAFALPGKVDAKRDTMLLPCTFSP
551 DGNRLVVFHGSDQSPYQAFIVDILTGKSVAALEGEPSWSQAVFSSDGRLL
601 AMTETNVLAIWDTSTGRKLKTWKMATAVFAFHPTRPLLVVAEPNGESETR
651 LGFWDFSAEVEKK

Name Aliases LCA Taxa Group Subgroup
ECFp2603
  • hypothetical protein
  • GEMOB_RS23530
Gemmata obscuriglobus UQM 2246 ECF57 ECF57s2

>ECFp2603 ECF57 ECF57s2 Gemmata obscuriglobus UQM 2246

1 MSAPLSSLLGHVRGLDSARGASATDAELLSGFAAHCDEAAFTTLVQRHGP
51 MVLRVCRRVLRHEQDAEDAFQATFLTLARRAAAVRKGEALASWLHGVACR
101 TAASARRAAARRRAHEERARLAPVTAPGEEFAWREVQSALDEEVQRLPEK
151 YRAVFVPCCLEGESRAEVARQLGEKEGTVSSRLAEARNLLRRRLARRGIT
201 LSALLTAVAVTQGTGRGGVPAALARSTVRAAGMLARGASAGVSHRVLTLI
251 GRGGVNRPGLVTGALVLTLLAAGLVVGAATTADQPPAGDSPVRSPVAALA
301 PEEPVRNPERTDRHGDPLPEGAVARIGTQRFRHGGGSVNRVLPTPDGKML
351 VSKNYYGDASVLVWELATGRLLHQFPGHYKENRAVALSPDGKTLALGQDK
401 VIRFYDLTSGKEVRNLSSSIGGTDGLAFSPDGKVLASGHGCNTVLLWDLA
451 GGKVQSQLQAEQNQVSNLVFSPDGKTLATGDTIDTLIRLFDVATGKERQQ
501 IRCAVFAREFAFSPDGKTLAVGAQEGAASLWDVTTGKPIRELHSPNKYVR
551 SLAWSPDGKSLATGDLDDETQVVAVRLWDPATGKELRQMQMNGAVGMAES
601 LAFTADGKTLICGGSHGVIRLWDPATGAEKSPTGLPGPVRHMAVSPDGKT
651 LAFSARDITLWDLTAEREIGTLPGHHWSFTFAPDGKTLAGGNDMNGLNVW
701 DVTGRRLLSQVKVDPQKENLKWVAFDCVAFSPDGKVIATAGRELNETAGR
751 ELNGSDRYPVVRLWETATGRQIREHCYKDEIYDMPGSVAFSPDGTLLVTS
801 GAVLERDGAVCVLDMSGAQDQSRLQQMINRSLGKTKRRFIGQIPEPRVAF
851 SPDGRLLAMNRSEEGIPVWEMATGRERCLLRGHDGPTSAVAFSADGRTLA
901 SAGWDHTIRVWNVETATELKRLKGHRGQVNALVFTPDGRRLISAGNDSTV
951 LFWDVLDLTRRPRPALRLGPSEWDALWADLAATDAGKAHAALARLTAAPA
1001 VTVPAVRERVRPAPEPDVRLLAQLVRDLNSEEFAAREKASQELGRLGESV
1051 EAAVKSARKGASPEAARRCDELLTKLAVLSGDRLRGVRAVEVLERIGTPE
1101 AVTVLESLARGAPQARLTRDARAARDRLARSAGDR

>ECFp26111 ECF57 ECF57s2 Planctomycetaceae bacterium SCGC AG-212-F19

1 MDNRPLKPVIRYIRQMAGTVEPPADHLLLDSFRSQQDEAAFASLVEKHGP
51 LVLAVCRRVLHNEHDAEDVFQSTFLVLAKKAGSIRQHESLGGWLYRVAYH
101 LALRVKARLVRRQEKEAEALPPDADDPAGDISWRELRGVLDEELARLPDK
151 YRMPLVLCYLAGKTRDEAAEELGWSVGAVKGRLERGRDLLRARLERRGLT
201 LSAALLGTMLASGQASAAVPATLLGATVKAAGAVASGTAVVVSPCVLDLA
251 RYGIGMFGVGKIKVAAVLLVAFLLTGLGVVMLGGNPFGANLADGDLGPSA
301 PPPAPAFVDITKECGLEKIVADKYAASPKWWLSGLHLVDLDGDGHLDFFM
351 SAHGEGGAVAALNDGKGNFKLAPGNYPSTEIHLAYDVNEDGLIDLTMTYR
401 DGGGQWWINKSKPGTLDFEAIPASQRGTNTARRQAMIDINRDGKVDWIRG
451 TPPALIFEHGDGKGGFTNNSGRLNTGNAGRGESLCIPVDLFGSGHIDFIV
501 EYGHYDFAVGHSRVFKNDGKGNFTDVTREIGLPTDGISIKGVGDLNGDGL
551 LDLIVLEDKKPELYLNDGKGKFVKKPGALIGMDKASRVNYSSWGLAVVTD
601 IDNDGVPDIIWNGKNFLWVLRGQGDGTFKYMNAEWGIKDTCASSVDDGLC
651 FGDINGDGMLDIIGYTAIGNQRQFAVYRNNLPRQNYLNVRPIGLPGNKGA
701 AGAKIRLYAAGTQQLLWYEHVAIWDSQAAQSYYSFAETERHFGLGKRDAV
751 DVVVEFYPSGKKVERKNVKANTTVRVPESDTP

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more