ECF proteins of ECF group ECF46

Displaying ECF 1 - 20 of 61 in total
Name Aliases LCA Taxa Group Subgroup
ECFp2194
  • hypothetical protein
  • RB11473
Rhodopirellula baltica SH 1 ECF46 ECF46s1

>ECFp2194 ECF46 ECF46s1 Rhodopirellula baltica SH 1

1 MRGWEFGLWLRMARTLWHRTGDFVKIRERLVIKEVARISKHVRHHFSGDI
51 LDETTRQATRHWTLAQPAVSAFIASVVRDFRDRDDVLQDVAVAVIESFDS
101 YDANSPFIPWAIGIAKRQVGLYLRRRGRDPLVFDDDAVACLAVAFDEEAK
151 ARSGAFDFLGDCVGLLDGRAKTLIELRYRGDMKPAAIASQTDMTPNSVAK
201 ALQRIRDQLRECIQRKSLEAGVQ

Name Aliases LCA Taxa Group Subgroup
ECFp2197
  • rfaY
  • RB9728
  • ... more
Rhodopirellula baltica SH 1 ECF46 ECF46s1

>ECFp2197 ECF46 ECF46s1 Rhodopirellula baltica SH 1

1 MDETARQATRQWTLAQPAVSAFVTSMVRDFGDRDDVLQEVAVAVIESYDS
51 YDPELPFVPWAIGVARNQVNLYMRNRRKDLLVFDDDAIACLAVAIPTVAQ
101 QDSAKLDFVTECLGGLENRARRLFELRYQKNMKPAAIAERVDMSANSVAK
151 ALQRIRDRVRNCVERKSVEAMS

Name Aliases LCA Taxa Group Subgroup
ECFp2198
  • ECF-family RNA polymerase sigma factor
  • RB912
  • ... more
Rhodopirellula baltica SH 1 ECF46 ECF46s1

>ECFp2198 ECF46 ECF46s1 Rhodopirellula baltica SH 1

1 MWTSAQPVVAAFVASVVRDRRDREDVLQETALAVLNSFESYDSSQAFQGW
51 AIGVARNQISLYLRRRRRDRLVFNEETIANLQSTFEQSSPPEELDHLPTC
101 IDQLSGRSRKICELRYQKGLKPIAISEQIGMTANSVSKALQRIREQLREC
151 IEDKFVSEGANG

Name Aliases LCA Taxa Group Subgroup
ECFp2200
  • RNA polymerase sigma-70 factor
  • DNA-directed RNA polymerase sigma-70 factor
  • ... more
Planctopirus limnophila DSM 3776 ECF46 ECF46s1

>ECFp2200 ECF46 ECF46s1 Planctopirus limnophila DSM 3776

1 MDDHTRQATRLWTLAQPVVSAFVVSAVRDFTARDDVLQETAVAVMESFDR
51 YDPQRPFVAWAMGIAQNQVRLYLRRIQRDRLVFDEDVLVQLAAAFEEAFP
101 EQSPSLGFLRGCLDQLEGRARELCELRYGRDLKPTAIAESLGMSGNTVSK
151 ALQRIREQLRACIERKVSFEKGMP

>ECFp68143 ECF46 ECF46s1 Rhodopirellula baltica SH28

1 MDETARQATRQWTLAQPAVSAFVTSMVRDFGDRDDVLQEVAVAVIESYDS
51 YDPELPFVPWAIGVARNQVSLYMRNRRKDLLVFDDDAIACLAIAIPTVAQ
101 QEAAKLDFVTECLGGLEDRARHLFELRYQKNLKPAAIAKRVDMSANSVAK
151 ALQRIRDRVRNCVERKSVEAMS

>ECFp68128 ECF46 ECF46s1 Rhodopirellula baltica SH28

1 MQTQFQELRVDDSTRHATRLWTSAQPVVAAFVASVVRDRRDREDVLQETA
51 LAVLNSFESYDSSQAFQGWAIGVARNQISLYLRRKRRDRLVFNEETIANL
101 QSTFEQSSPPEELDHLPTCIDQLPGRARKICELRYQKGLKPITISEQIGM
151 TANSVSKALQRIREQLRECIEDKFVSEGANG

Name Aliases LCA Taxa Group Subgroup
ECFp68139
  • RNA polymerase sigma70
  • transcriptional control
  • ... more
Rhodopirellula islandica ECF46 ECF46s1

>ECFp68139 ECF46 ECF46s1 Rhodopirellula islandica

1 MDDSTRHATRLWTSAQPVVAAFVASVVRDRRDREDVLQETALAVLNSFES
51 YDSSQAFQGWAIGVARNQISLYLRRRRRDRLVFSEETIANLQSTFEQSSP
101 PEELDHLPTCLDQLPGRARKICELRYQKGLKPIAISEQIGMTANSVSKAL
151 QRIREQLRECIEDKFVSEGANG

>ECFp68156 ECF46 ECF46s1 Rhodopirellula baltica

1 MAAFVASVVRDRRDREDVLQETALAVLNSFESYDSSQAFQGWAIGVARNQ
51 ISLYLRRRRRDRLVFNEETIANLQSTFEQSSPPEELDHLPTCIDQLSGRS
101 RKICELRYQKGLKPIAISEQIGMTANSVSKALQRIREQLRECIEDKFVSE
151 GANG

>ECFp68162 ECF46 ECF46s1 Rhodopirellula europaea SH398

1 MDDSTRHATRLWTSAQPVVAAFVASVVRDRRDREDVLQETALAVLNSFES
51 YDSSQAFQGWAIGVARNQISLYLRRKRRDRLVFNEETIANLQSTFEQSSP
101 PEELDHLPTCIDQLPGRARKICELRYQKGLKPIAISERIGMTANSVSKAL
151 QRIREQLRECIEDKFVSEGANG

>ECFp68164 ECF46 ECF46s1 Rhodopirellula baltica SH28

1 MDDSTRHATRLWTSAQPVVAAFVASVVRDRRDREDVLQETALAVLNSFES
51 YDSSQAFQGWAIGVARNQISLYLRRKRRDRLVFNEETIANLQSTFEQSSP
101 PEELDHLPTCIDQLPGRARKICELRYQKGLKPITISEQIGMTANSVSKAL
151 QRIREQLRECIEDKFVSEGANG

Name Aliases LCA Taxa Group Subgroup
ECFp68235
  • RNA polymerase sigma70
  • transcriptional control
  • ... more
Rhodopirellula islandica ECF46 ECF46s1

>ECFp68235 ECF46 ECF46s1 Rhodopirellula islandica

1 MDETARQATRQWTLAQPAVSAFVTSMVRDFRDRDDVLQEVAVAVIESYDS
51 YDPELPFVPWAIGVARNQLSLYMRNRRKDRLVFDDDAIACLAIAVPTVAQ
101 QESAKLDFVTECLGGLENRARHLFELRYQKDMKPAAIAERVDMSANSVAK
151 ALQRIRDRVRACVERKSLEAMS

>ECFp68249 ECF46 ECF46s1 Rhodopirellula baltica SWK14

1 MSAFVTSMVRDFGDRDDVLQEVAVAVIESYDSYDPELPFVPWAIGVARNQ
51 VSLYMRNRRKDLLVFDDDAIACLAIAIPTVAQQEAAKLDFVTECLGGLEN
101 RARRLFELRYQKNLKPAAIAKRVDMSANSVAKALQRIRGRVRNCVERKSV
151 EAMS

>ECFp68271 ECF46 ECF46s1 Rhodopirellula baltica SWK14

1 MDETARQATRQWTLAQPAVSAFVTSMVRDFGDRDDVLQEVAVAVIESYDS
51 YDPELPFVPWAIGVARNQVSLYMRNRRKDLLVFDDDAIACLAIAIPTVAQ
101 QEAAKLDFVTECLGGLENRARRLFELRYQKNLKPAAIAKRVDMSANSVAK
151 ALQRIRGRVRNCVERKSVEAMS

>ECFp68251 ECF46 ECF46s1 Rhodopirellula baltica SWK14

1 MDDSTRHATRLWTSAQPVVAAFVASVVRDRRDREDVLQETALAVLNSFES
51 YDSSQAFQGWAIGVARNQISLYLRRRRRDRLVFNEETIANLQSTFEQSSP
101 PEELDHLPTCIDQLSGRSRKICELRYQKGLKPIAISEQIGMTANSVSKAL
151 QRIREQLRECIEDKFVSEGANG

>ECFp68299 ECF46 ECF46s1 Planctopirus hydrillae

1 MDDRTRQATRLWTLAQPVVSAFVVSAVRDFTARDDVLQETAVAVMESFDR
51 YDPQRPFVAWAMGIAQNQVRLYFRRVQRDRLVFDEDVLVQLAAAFEETFP
101 EQSPSLGFLRGCLDQLEGRARELCELRYGRDLKPAAIAESLGMSGNSVAK
151 ALQRIRDQLRACIERKVTFEKGMP

>ECFp68157 ECF46 ECF46s1 Rhodopirellula baltica WH47

1 MDETARQATRQWTLAQPAVSAFVTSMVRDFGDRDDVLQEVAVAVIESYDS
51 YDPELPFVPWAIGVARNQVSLYMRNRRKDLLVFDDDAIACLAIAIPTVAQ
101 QEAAKLDFVTECLGGLENRARRLFELRYQKNLKPAAIAKRVDMSANSVAK
151 ALQRIRDRVRNCVERKSVEAMS

>ECFp68189 ECF46 ECF46s1 Rhodopirellula sp. SWK7

1 MDETARQATRQWTLALPAVSAFVTSMVRDFGDRDDVLQEVAVAVIESYDS
51 YDPELPFVPWAIGVARNQVSLYMRNRRKDLLVFDDDAIACLAIAIPTVAQ
101 QEAAKLDFVTECLGGLENRARRLFELRYQKNMKPAAIAERVDMSANSVAK
151 ALQRIRDRVRNCVERKSVEAMS

>ECFp68192 ECF46 ECF46s1 Rhodopirellula europaea SH398

1 MDETARQATRQWTLAQPAVSAFVTSMVRDFRDRDDVLQEVAVAVIESYDS
51 YDPELPFVPWAIGVARNQVSLYMRNRRKDLLVFDDDATACLAIAIPTVAQ
101 QESAKLDFVTECLGGLENRARHLFELRYQKDMKPAAIAERVDMSANSVAK
151 ALQRIRDRVRACVERKSLEAMS

>ECFp68178 ECF46 ECF46s1 Rhodopirellula baltica WH47

1 MDDLTRHATRLWTSAQPVVAAFVASVVRDRRDREDVLQETALAVLNSFES
51 YDSSQAFQGWAIGVARNQISLYLRRRRRDRLVFNEETIANLQSTFEQSSP
101 PEELDHLPTCIDQLSGRSRKICELRYQKGLKPIAISEQIGMTANSVSKAL
151 QRIREQLRECIEDKFVSEGANG

Name Aliases LCA Taxa Group Subgroup
ECFp68182
  • DNA-directed RNA polymerase sigma-70 factor
  • OSO_RS0133310
Schlesneria paludicola DSM 18645 ECF46 ECF46s1

>ECFp68182 ECF46 ECF46s1 Schlesneria paludicola DSM 18645

1 MDEKTRRLTRMWMSAQPIVSSFVSTMVHDFAARDDIMQEVIAAVVESFDK
51 YDPEKPFVGWLLGIARNQVGLYRRRSHRDRLVFDDSTVDQLACAFSELPD
101 GEIHKLEFLRGCLEKLSERDRRLCDLRYEQDLKPSGIATTLGITSNRVSK
151 ALQRIRDQLRNCIERQVAQAKGAL

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more