ECF proteins of ECF group ECF41

Displaying ECF 1 - 20 of 12157 in total

>ECFp12387 ECF41 ECF41s3 Streptomyces sp. IMTB 1903

1 MDMATIDRFEAGRGRLASLAYRLLGSAADAEDAVQDAFLRWQAADRERIE
51 VPEAWLTKVVTNLCLDRLRSAQARHERAVGDWLPEPLLDGDPMLGPADTV
101 EQRESVSLAVLTLMERLSPVERAAYVLREAFSYPHAEIAGILDITESASQ
151 QHVHRARRRVAAERRGGGEVDPAAARRVVEEFLTAAMSGRTDRLVALLTA
201 DATAVSDGAGLARRLLRHRTPERIASYVRAGLRPTEAKRRLAGGSPAFHL
251 ARVNGSTAVIAVVGDRVVGAVAFEVSDGKVASLRGVAAAHRLARLNETWA
301 RYEGEAPVVGAW

>ECFp10697 ECF41 ECF41s3 Streptomyces sp. NRRL S-4

1 MALTMNDMDRFEASMPRLKAIAYRLLGSATDAEDAVQDTYLRWQAADTGR
51 IEVPEAWLTKVLTNLCLNQLTSARARRETYVGQWLPEPLLTGDPMLGPAD
101 TAEQRESVSYAVLTLMERLSPNERVVYVLREAFDYPHRRIAEILDITEAS
151 CQQIFHRARKHVAEGRTRTEIDEAAAGRIVAEFLTAATSGRTEPLVRLLT
201 DDAVSIGDGGGKVPARATPFEGALAVARFMRGMFTPGKAKRALVGGSPSV
251 YAATANNTPALVVVLDGRVIAVMCLEITADGIAAFRSQVNPDKLERATRQ
301 WAATDHGEPLLIPF

>ECFp10711 ECF41 ECF41s3 Salinispora pacifica CNT001

1 MPLRSHEVELFEHSRARLEAIAYRLLGSASDAEDAVQETFLRWQATDRTA
51 VRTPEAWLTKALTNLCLNQLTSARARRERYVGTWLPEPLLPGDPMLGPVD
101 TVEQRESVSMAVLVLLERLSANERVVYVLRAAFGYSHGEIAEFLDLTESN
151 CQQIYRRAKQHISTDRVRAEVDATSTRKVVEEFLVAATSGEVRRLVELLT
201 ADATSVGDGGGKVPARTTPVAGALAVARFLRGLLVPTKVKRDRIGGRPAV
251 YAGVVNGGPAVVVVLDDRVVAVMSLHLTGEGIAAIHTQVNPDKLVRATHR
301 WSAAEPGEPLIEAW

Name Aliases LCA Taxa Group Subgroup
ECFp10872
Streptomyces sp. CC71 ECF41 ECF41s3

>ECFp10872 ECF41 ECF41s3 Streptomyces sp. CC71

1 MARTSHDVDLFMAAKPRLEAIAYRLLGSASEAEDAVQETFLRWQEADSDL
51 VRVPEAWLAKVLTNLCLNQLTSARARRETYVGAWLPEPLIAGDPMLGPAD
101 SAEQREAVSYAVLVLLERLSPNERAVYVLREAFGYSHREIAEILDVSEAA
151 SQQILHRAKKHVAQGRARAEVDEAAARRVVEEFLVAATSGRTEPLVRLLT
201 ADAVAIGDGGGKVPARAKAFEGALAVATFLRGLFKPGPAKRALLGGSAGI
251 YATTANGDPAVVAVVDGQVVGVMCLELTAEGITAVRSQVNPDKLERVTRR
301 WAAADHGEPLFSAF

>ECFp10883 ECF41 ECF41s3 Rhodococcus phenolicus

1 MPTREHDVDLFERSRGRLEAIAYRLLGSAGDAEDAVQDTYLRWHTVDRDN
51 IEIPEAWLTKVLTNLCLNRLTSARARRETYVGQWLPEPLLDGDRMLGPAD
101 TAVQRDTVSMALLTLLERLSPNERVVYVLREAFGYPHREIASILGITEAN
151 CQQIHRRARQHIAADRVRAEVDAVAAARIAEQFVAAALTGDTEPLIAMLT
201 ADAVSIADGGGRVPARRGPVAGARAVARYLRGLFRPTDAKRAVIGGSPTV
251 HTAVVNGGPAVLVEVNGRVAGVFCLDVTAGRVAGLTIQVNPDKLGRITRS
301 WAATGPHVPLVARW

>ECFp10896 ECF41 ECF41s3 Streptomyces sp. NRRL F-5193

1 MTSHPAPDERPDTDAEAAAREFTAHRPRLFGIAYRMLGSAAEAEDTVQDA
51 YLRWSDADRIGLVHPGAWLAKVVTRLCLNRLTSARATRERYTGPWLPEPV
101 LTAGGGLPGAPGTGPLEAAERRDEVSTALLLLLERLTPAERAVYVLREAF
151 GYPHREIAGLLDLGEANCRQLYGRAARRVAGPGDDGAAARFDPPAPERHR
201 EFVESFVAAAREGDLAGLEKVLAADVVWWGDGGGKVRSALRPVRGRDHVL
251 RFLAGVARRTEEGARLTVVEVNGAPGVVLHVGARVLGVASVDVRPDGLVT
301 DVRMVMNPDKLGYAARQFAAYPESGA

>ECFp10911 ECF41 ECF41s3 Actinobacteria bacterium OV450

1 MITQDAAPVADFEEHRPRMFSIAYRMLGSATEAEDTVQDAWLRWSSADRG
51 DVEHPGAWLAKVVTRLCLNRLDSARARREQYVGPWLPEPVLTGDGTLGPL
101 ESAEQRDSVSLALLVLLEQLTPVERAVYVLREAFTYGHREIAGLLDLTEA
151 NCRQLYRRAAARVAEGRTAASHPRFEPDPERLRTLVETFLTAARDGDLAR
201 LEGMLTADVRYVSDGGGVVKAALRPILGRDKVARFLVGALRKYAADLPVS
251 FAEVNGEPALIVGGAAVLQVEVEGGLIRGMRTVLNPEKLEFLRRQLSRF

>ECFp10989 ECF41 ECF41s3 Mycobacterium sp. 1081908.1

1 MTDVAQDFESQRPRLFWLAYRLLGSASEAEDAVQDAYLRLHGADAEAIES
51 LPAWLTTTVTNLCLNRLTSARARREVYPGPWLPEPVLTDERTLGPLETTE
101 QRESVSIALLSLMERLGPTERAAFVLREAFAYSHFEIAEILQTSEANARQ
151 LYRRAKERLGESRRRFQPDRRQWRRLVDRFFTAARAGDVDGLVEILTDDV
201 TSTADGGGKVGAARRVISGRDRMAHYVARVFGRNLAQMPMRVEVAEVNGE
251 PAMLAFDADRLAGVLCFDIADDRIAALRVMANPDKLRFLAGQLSHPAGLP
301 GS

>ECFp16573 ECF41 ECF41s3 Herbidospora sakaeratensis

1 MTPERLARFEANRRRLFGVAYRLLGEASAAEDVVQDAYLRWERCDSAVVP
51 EAWLTKVVTNLCLDRLTSARAQRERYVGTWLPEPILTGGAGDPLEVVAQR
101 ELLSIGMLVLLERLTPPERAVFVLREAFGHSHREIAEVLDVTEPHVRQLY
151 RRAQRHLAEERRRFTPAPEQGEELLKRFMAATLAGDVAALERLLADDVVA
201 WADGGGKAPATRVAVSGREQVLRHLLALTRYAPRVRLEPETVNGQPALAF
251 YLDDELAGVTVVEFDGGRVTTIHAVANPDKLAYLAQQKS

>ECFp11033 ECF41 ECF41s3 Mycobacterium sp. 1164966.3

1 MTDLVEDFEAQRPRLFWLAYRLLGSASEAEDAVQDAYLRLHGADSALIES
51 LPAWLTKAVTNLCLNRLTSARARREVYPGPWLPEPVLTDDRTLGPQETAE
101 QRESVSIALLSLMEQLKPNERAAFVLREAFAYSHLEIAEILEMSEANVRQ
151 LYRRARQRLGGPRQAVHRPDRAQWRSLVDRFFTAASAGDVAGLVEILTAD
201 ATSTADGGGKVAAARRPISGRDRMAQYVARVFTRNLAQIQLRLDAAEVNG
251 EPAMLAFDGDTLAGVLCFEITGDRIAAVRILANPDKLRFLAEQLSHPAGL
301 SGP

>ECFp11189 ECF41 ECF41s3 Amycolatopsis orientalis

1 MLIGAREVELFEGARGRLEAIAYRLLGSANDAEDAVQDTFLRWQSADREL
51 IETPEAWLTKVLTNICLNRLTSARARRETYVGQWLPEPVFAGDRMLGPSD
101 TVEQRESVSIAMLALMERLSAKERVVYVLREAFGYSHGEIAEVLDLTESN
151 CQQIYRRAKQHLAAERRRVPVDAAAARKIVEEFLAAALSGKTDSLVRMLT
201 DDAISVGDGGGVLFSLPRPVTGATRVARFLHGLFKPSAAKWSLIGGRPVL
251 FAAVVNGMPALVLEVEGQIAGIVTLDVTDDGIAAVHAQVNPAKLERAERH
301 WAVADQGEPLPDTW

>ECFp11060 ECF41 ECF41s3 Streptomyces puniciscabiei

1 MTPPPHADEFESHRPRLFGLAYRLLGSAHEAEDAVQDAYLRFSGADRAAI
51 EHPGAWLAKAVTNLCLTRLTSARARREEYPGPWLPEPVATSDGTLGPLES
101 AERREQVSMALLVLLERLTPTERAVYVLREAFGYGHREIAGVLDLSEANC
151 RQLYRRAVARVAAPEGRFEPAPQRQEELLTSFLTAAREGDMAGLEKLLAA
201 DVTYWGDGGGRVSAALRPIVGREKVMRFLMGGAERFTKGLDFAVVEVNGA
251 GALVARAGDMLVGVASFELRDGLITHVRTVMNPDKLAYVQRQLARS

>ECFp11225 ECF41 ECF41s3 Streptomyces mutomycini

1 MALTMNDMDRFEASMPRLKAIAYRLLGSATDAEDAVQDTYLRWQAADTGR
51 IEVPEAWLTKVLTNLCLNQLTSARARRETYVGQWLPEPLLTGDPMLGPAD
101 TAEQRESVSYAVLTLMERLSPNERVVYVLREAFDYPHRRIAEILDITEAS
151 CQQIFHRARKHVAEGRTRTEIDEAAAGRIVAEFLTAATSGRTEPLVRLLT
201 DDAVSIGDGGGKVPARATPFEGAPAVARFMRGMFTPGKAKRALVGGSPSV
251 YAATANNTPALVVVLDGRVIAVMCLEITADGIAAFRSQVNPDKLERATRQ
301 WAATDHGEPLLIPF

Name Aliases LCA Taxa Group Subgroup
ECFp11232
  • DNA-directed RNA polymerase sigma-70 factor
  • OP18_RS45960
Dactylosporangium aurantiacum ECF41 ECF41s3

>ECFp11232 ECF41 ECF41s3 Dactylosporangium aurantiacum

1 MALTVGDVARFEAARPRLEAIAYRMLGSAAEAEDAVQETFLRWQGAGHER
51 IEVLEAWLTKVLTNICLNQLTSARARREVYVGQWLPEPLLAGDPMLGPAD
101 TVEQRESVSYAVLTLLERLTPNERAVYVLRAAFDYPHREIAAILDISEAT
151 SQQIFHRARQHVAEGRARTEIDEAAARRIVEEFLAAATSGRTEPLVRLLT
201 GDAVSIGDGGGKVPARAKAFEGALAVAKFVRGLFQPGAAKRAAAGGSAEI
251 YATTANGGPAVVAVVDGRVVGVMCLEVTAGGIAALRNQVNPDKLGRATER
301 WAASGGHGKPLFTAF

>ECFp11462 ECF41 ECF41s3 Mycobacterium intracellulare 1956

1 MSDVVRDFESQRPRLFGLAYRLLGSASEAEDAVQDAYLRLHRADAEAIES
51 LPAWLTTAVTNLCLTRLTSARARREVYPGPWLPEPVLTDDRTLGPLETAE
101 QRESVSIALLSLMERLGPTERAAFVLREAFAYSHFEIAEILETSEANARQ
151 LYRRARQRLGEPRRRFQPDRAQWRRLVERFFTAARAGDVDGLVEILTDTV
201 TSTADGGGKVAAAGASSRAAIGRPAMWRACSAGTWRRRVRVSTSPRSTAS
251 PRCWRSTATRWPASCASTSPGTR

Name Aliases LCA Taxa Group Subgroup
ECFp11482
  • RNA polymerase subunit sigma-24
  • ON30_RS25150
Nocardia takedensis NBRC 100417 ECF41 ECF41s3

>ECFp11482 ECF41 ECF41s3 Nocardia takedensis NBRC 100417

1 MDSEGLREFQAHRPRLFALAYRMLGSASEAEDAVQEVWLRWDGTDRAFIR
51 SAEAWLTTAVVNLCRTWLVSARARRESYVGPWLPEPVPTARGELGPLETV
101 EEREQVSLALLTALERLSAVERAVFVLREAFGYAHREIADMLDISESLSQ
151 QTYRRAGQRVRADRPRFEVDTARAGVLIERFLNAARTGELAALERMLTAD
201 VTAVADGGGRVNAARKPVVGAVKVSRYLAGLFRFLDDTMTVSTVEVNGVP
251 AVVIRQAGAALAVIAVEFEDGAVAAVRLLVNPDKLTRLEATESV

Name Aliases LCA Taxa Group Subgroup
ECFp11616
  • DNA-directed RNA polymerase sigma-70 factor
  • OP79_RS03490
Streptomyces yerevanensis ECF41 ECF41s3

>ECFp11616 ECF41 ECF41s3 Streptomyces yerevanensis

1 MDSVAIDRFEASRGRLASLAYRLLGSAADAEDAVQDAFLRWQAADRERIE
51 VPEAWLTKVVTNLCLDRLRSAQARHERAVGDWLPEPLLEGDPMLGPADTF
101 EQRESVSLAVLTLMERLSPVERAAYVLREAFSYPHAEIAGILDITESASQ
151 QHVHRARRRVAAERRGGDEVDPASARRVVEEFLAAATSGRTERLVALLTD
201 DVTMVSDGAGLAKRLLRYKTRERVASYVRAGFKPTPAKRRLAGGSPAMHI
251 ALVNGSPAVLAVVDDRVVGAVAFEVSDGKVASLRGVAAANRLARLNEAWR
301 QHEPNAPVINAW

Name Aliases LCA Taxa Group Subgroup
ECFp11673
Streptomyces katrae ECF41 ECF41s3

>ECFp11673 ECF41 ECF41s3 Streptomyces katrae

1 MFGIAYRMLGSAAEAEDTVQDAWLRWSSAGREDIEHPGAWLAKVVTRLCL
51 NRLTSARARREEYVGPWLPEPVLTGDGTLGPLESAEQRDSVSMALLVLLE
101 QLTPVERAVYVLREAFAYGHREIAGLLDLTEANCRQLYRRAAARVAAGRT
151 AGPSGGRESRPRFEPDPAQWQRLVETFLTAARDGDLARLEGMLTADVRYV
201 ADGGGIVGAARRPILGPDKVARFLVGVLRKFAAGMPISFAEVNGEPALIV
251 GGTVLQVEIEDGLVREVRSVVNPEKLEFLQRQLSHS

>ECFp11729 ECF41 ECF41s3 Streptomyces sp. MBT28

1 MDSAALAQFEAGRGRLASLAYRLLGSAADAEDAVQDTFLRWQAADRERVA
51 VPEAWLTKVLTNLCLDRLRSAQARHERAAGDWLPEPLLAGDPMLDPADTV
101 EQRESVSLAVLTLMERLAPVERAVYVLREAFSYTHAEIAGILDITESASQ
151 QHAHRARARVTAERRRGGETDPATARRVVEEFLAAATSGRTERLVALLTD
201 DVTAVSDGAGLARRLLRYRTPERVASFVRGGFRPTAAKRRLAGGSPAFHI
251 APVNGSPAVLAVVDGRVVGVVVFGVSDGKVASLHGIAAAGRLARVAETWR
301 RHRPDAPAVATW

Name Aliases LCA Taxa Group Subgroup
ECFp11758
  • DNA-directed RNA polymerase sigma-70 factor
  • IF61_RS0130810
Streptomyces roseoverticillatus ECF41 ECF41s3

>ECFp11758 ECF41 ECF41s3 Streptomyces roseoverticillatus

1 MVRVDSIGVDRFDTSRFEASRNRLASLAYRLLGSAADAQDAVQDAFLHWQ
51 AADRQQIKVPEAWLTKVVTNLCLDRLRSAQVRRERAVGAWLPEPLLGGDP
101 MLGPADTFEQRESVSLAVLTLMERLSPLERAVYILREAFSYGHAEIAEIL
151 DITESASQQHLHRARTRITAARRRSSEVDPASARKIIEEFLAAATSGRTD
201 RLVALLTDDAIAISDSNGAGPAKTLLRYDTPERIATMARAGFRPTPAKRR
251 LAGGALAVHYALVNGAPAILFVLGDQVVGTVTFDVTDGKIATVRGIAAPT
301 RLVRITEAWRQRGPDRPLITQW

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more