ECF proteins of ECF group ECF38

Displaying ECF 1 - 20 of 1490 in total

>ECFp149965 ECF38 ECF38s8 Streptosporangium canum

1 MLSHGEPLARDRVDVAALFADHHLGLVRLALLMVGDQATAEDVVQEAFTR
51 THAGRRRLRDPERALAYIRSAVLNGSRSVLRRRAVAFRRAVPYEPPVWSA
101 EHAALLGEERREVLVALRALPRRQREALTLRYYLDLSDLEIAETMGIGAG
151 TARSTIARGLAALARKLGEES

>ECFp86968 ECF38 ECF38s8 Microtetraspora niveoalba

1 MKAELLSERELLIRERVDVAALFADHHLGLVRLALLMVGDLATAEDVVQE
51 AFARTHAGRGRLRDPGSALAYVRSAVLNGCRSVLRRRSLAFRRAVPYAPP
101 VWSAESVAMIGEDRREVLVALSGLPRRQREALVLRFYLDLSYEEIADTMG
151 VAGSTARSTITRGLAALARTLGEES

Name Aliases LCA Taxa Group Subgroup
ECFp108368
  • ECF subfamily RNA polymerase sigma-24 subunit
  • RNA polymerase, sigma-24 subunit, ECF subfamily
  • ... more
Kribbella flavida DSM 17836 ECF38 ECF38s8

>ECFp108368 ECF38 ECF38s8 Kribbella flavida DSM 17836

1 MVSIGRPAGAVPVPDDAPAAVSRLYRQHWLGLVRLAVLVVDDRQSAEDLV
51 QEAFAELYRRWPLDDADKALGYLRTTVLNRSRSVLRRRRVARLYTPPALR
101 PEISAESEVVLSEDRLEVQQALRKLPTRTREVLVLRYYLDLPHAEIAQIL
151 GISESTARSTASRGLGILTEQLKESR

Name Aliases LCA Taxa Group Subgroup
ECFp168269
Nonomuraea maritima ECF38 ECF38s8

>ECFp168269 ECF38 ECF38s8 Nonomuraea maritima

1 MGLVRLALLMVGDQASAEDIVQEAFERTHAGRSRIRDADKALAYVRSSVL
51 NGCRSTLRRRARGFRRGVPYEPPAGSAESAALVGEERREVLLALRALPRR
101 QREALTLRYYFDLPDQEVADAMGIGASTVRSTITRGLAALARALGEDA

>ECFp100812 ECF38 ECF38s8 Microtetraspora glauca

1 MKAELLSHGEPLIRERVDVAALFADHHLGLVRLALLMVGDVGTAEDVVQE
51 AFARTHAGRRRLRDPGRALAYVRSAVLNGCRSVLRRRSVAFRRAVPYEPP
101 VWSAESVAMVGEDRREVLVALGGLPRRQREALVLRFYLDLSYEEIADTMG
151 VAGSTARSTITRGLAALGRILGEES

>ECFp102663 ECF38 ECF38s8 Actinomadura kijaniata NBRC 14229

1 MYRGHALGLMRLALLMVGDRPTAEDVVQEAFAGLYRRWGGLRDRDKALTY
51 LRSAVLNGSRKVLRRRRLPFRVQHQPPVWSAETAAMVGEDRREVLAALHR
101 LPARQREALVLRYFANLTEEEIAAAMGISRGTVKSTASRGIAALGRMLGE
151 DAG

Name Aliases LCA Taxa Group Subgroup
ECFp103376
Microtetraspora fusca ECF38 ECF38s8

>ECFp103376 ECF38 ECF38s8 Microtetraspora fusca

1 MLGDRETAEDVVQEAFLGLHRRFGGLRDRSKALVYLRSAVLNNARTVLRR
51 RRLPSWFAGTYEPPMWSAESAALLGAERREVMEALHRLPRRQREALVLRY
101 YADLSEEETAQVMGVSRGTVKSTTSRALDALGRLLGNAR

>ECFp103919 ECF38 ECF38s8 Microtetraspora niveoalba

1 MLGDRETAEDVVQEAFLGLHRRFGGLRDRSKALVYLRSAVLNNARSVLRR
51 RRLPSWFAGAYEPPVWSAESAALLGAERREVMEALHRLPRRQREALVLRY
101 YADLSEEETAQVMGVSRGTVKSTTSRALDALGRLLGNAR

>ECFp104539 ECF38 ECF38s8 Actinomadura kijaniata NBRC 14229

1 MAILLVGDEATAEDVVHDVFLRMQDRPPRLDDEGKLLAYVRAAVVNGCRM
51 VLRRRRWSWGRTEQHEPAVWSAESAAILSEDRREVMRALQRLPRRQREAL
101 VLRYYLDLTDEEVSQAMGIRPGTVRSTMTRALAALARELGGEVR

>ECFp105122 ECF38 ECF38s8 Actinomadura chibensis NBRC 106107

1 MSLLNFRRDGPPDLAAHSPEREVTRLYEAHALDLVRLALVMVGDRPTAED
51 VVQDSFLGLYRRWGRLKDTDKALTYLRSSVLNNCRTVLRRRGRRPHGVQE
101 DPPVASAESRVLDRERGREVLDALRRLPHRQRETLVLRFVLDLSEEETAR
151 IMRVSRGAVRSNTSRGRTALERMLGETP

Name Aliases LCA Taxa Group Subgroup
ECFp105242
  • RNA polymerase subunit sigma-24
  • A3G7_RS0119380
Nonomuraea coxensis DSM 45129 ECF38 ECF38s8

>ECFp105242 ECF38 ECF38s8 Nonomuraea coxensis DSM 45129

1 MEDPPPPPPATETPAEAAAVAELFSEHRLGLVRFAFLLLGDQETAEDVVQ
51 DAFAAVHRRWSRLADRDRLLPYVRTAVLNGCRAVHRRRAVARRFGVEREA
101 PFWSAETQALLGETRREVFAAVRGLSRRRREAVVLRYYLGLSEAETAEVM
151 GVSRGTVKSTVSRALDALAGKLKEGR

>ECFp105516 ECF38 ECF38s8 Planomonospora sphaerica

1 MELLSHGEPLARDRVDVARLFAEHHLGLVRLALLMVGDQATAEDVVQEAF
51 ARTHAGWRRLRDPDRALTYIRSAVLNGARSVLRRRAVAFRRAVPYEPPVW
101 SAEHAALLGEERREVLVALRDLPGRQREALVLRYYLDLSDLEIAETMGIG
151 ASTARSTLARGLAALARKLGEES

Name Aliases LCA Taxa Group Subgroup
ECFp169147
Microbispora rosea ECF38 ECF38s8

>ECFp169147 ECF38 ECF38s8 Microbispora rosea

1 MSGLYAEHALGLTRLALIMVGDRESAEDVVQEAFLGLHRRFDRLRDRDKA
51 LLYVRAAVLNNARTVLRRRRLPSRFAGTYDPPVWSAESVAILGAERREVM
101 EALHRLPRRQREALVLRYYAELSEEETARVMKISRGTVKSTTSRALDALG
151 RLLGETR

Name Aliases LCA Taxa Group Subgroup
ECFp107624
  • hypothetical protein
  • IF49_RS0115705
Microbispora rosea ECF38 ECF38s8

>ECFp107624 ECF38 ECF38s8 Microbispora rosea

1 MKAETLDLDQQPGGPVPVPSPSAGADDTISGLYAEHALGLTRLALIMVGD
51 RESAEDVVQEAFLGLHRRFDRLRDRDKALLYVRAAVLNNARTVLRRRRLP
101 SRFAGTYDPPVWSAESVAILGAERREVMEALHRLPRRQREALVLRYYAEL
151 SEEETARVMKISRGTVKSTTSRALDALGRLLGETR

>ECFp107635 ECF38 ECF38s8 Microtetraspora malaysiensis

1 MVRASPDVTVAELFAAHRLGLVRFAFLLVGDQETAEDVVQDAFAAVHRRW
51 RRLADRDQLLPYLRTAVLNGCRAVHRRRAIARRFGIDREVPFWSAESSAL
101 LGETRREVFAAVRDLPRRRREAVVLRYYLDLSEAETAAVMGVSRGTVKST
151 TARALRTLAEKLEEGR

Name Aliases LCA Taxa Group Subgroup
ECFp108965
  • RNA polymerase subunit sigma-24
  • IO39_RS02790
Nonomuraea candida ECF38 ECF38s8

>ECFp108965 ECF38 ECF38s8 Nonomuraea candida

1 MARQRVDVASVFAEHHVGLVRLALIMVGDQATAEDVVQEAFERTHAGRAR
51 LRDADKMLTYVRSAVLNGCRSVLRRRATVFKRAVPYEPPVWSAESAVLMG
101 EERREVLLALRRLPRRQREALTLRYYVDLTDQEIAETMRISAGTARSTIA
151 RGLAALARELGEDS

>ECFp112148 ECF38 ECF38s8 Nonomuraea sp. NBRC 110462

1 MFVVHGLSLVRLAFLLVGDQETAEDVVQDAFAAVYRRWGRLTDREQVLPY
51 LRAAVVNGCRMVLRRRAIIGRFRGRPEVPFWSAEAAALLGETRRQVFLAV
101 RALPRRQREVLVLRFYLDLSEAEIAQVMGVSRGTVKSTASRALKVLAVTL
151 QEER

Name Aliases LCA Taxa Group Subgroup
ECFp113939
  • RNA polymerase subunit sigma-24
  • RNA polymerase, sigma-24 subunit, ECF subfamily
  • ... more
Streptosporangium roseum ECF38 ECF38s8

>ECFp113939 ECF38 ECF38s8 Streptosporangium roseum

1 MSLSGTTPDPEIEMLSHGEPLARDRVDVAALFADHHLGLVRLALLMVGDQ
51 ATAEDVVQEAFTRTHAGRHRLRDPRRALTYIRSAVLNGSRSVLRRRAVAF
101 RRAVPYEPPVWSAEHAALLGEERREVLVALRALPGRQREALTLRYYLDLS
151 DLEIAETMGIGAGTARSTIARGLAALARKLGEES

>ECFp114015 ECF38 ECF38s8 Actinomadura macra NBRC 14102

1 MDIAEAQGQPRSRASSAPDEGALAVTLTTLFRDHHLSLVRTALMIVGDRA
51 TAEDVVQDAFVILHRKIDKLLDHERILPYIRGTVVNRCRHVLRRRRLALR
101 TGRTHEPPVWSAESAALLGEERREVFLALRRLPARQREALVLRYYLDLTE
151 SEIAEVMGVSRGTVKSTTSRGLRTLGKRLETKRGEES

>ECFp114184 ECF38 ECF38s8 Planomonospora sphaerica

1 MSLSGTTPEPEIELLSHGEPLARDRVDVARLFAEHHLGLVRLALLMVGDQ
51 ATAEDVVQEAFARTHAGWRRLRDPDRALTYIRSAVLNGARSVLRRRAVAF
101 RRAVPYEPPVWSAEHAALLGEERREVLVALRDLPGRQREALVLRYYLDLS
151 DLEIAETMGIGASTARSTLARGLAALARKLGEES

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more