ECF proteins of ECF group ECF293

Displaying ECF 1 - 20 of 2167 in total

>ECFp112679 ECF293 ECF293s25 Agrobacterium sp. RAC06

1 MEDNECDDAILLPRLVVGDRMAFQRLFRLHNAPMIRFATGIVRSRHVAEE
51 VVQDTWVSVLGRIDLFEGRSSLASWIYAILVNKARTVAKREGRIVFFDDA
101 GDGNGLADAFDGRGRWRDIPELWDELTPDRHVEGRSVLQHVEAAIEALPP
151 AQRAVLILRSQQELEAKEVCTLLGMSEGNMRVLLHRARVNVRNVLDRLNK
201 DL

Name Aliases LCA Taxa Group Subgroup
ECFp39684
Rhizobium sp. AAP116 ECF293 ECF293s25

>ECFp39684 ECF293 ECF293s25 Rhizobium sp. AAP116

1 MTQVEGDDQALVLRLVDGDAAAFDILYRRHNAALIRFCTGIVQHRHLAEE
51 VVQDTWIAVLGRIDLFEGRSSLASWIYTILINKARSRARREGRTVFFDDH
101 ASGDSLADAFDGRGHWRQIPELWENLTPERHIEGRSVLQHVEEVIDTLPP
151 TQRAVLILRGQQELDPSEVCALLNISEGNMRVLLHRARLAVRNALDRLNA
201 VS

Name Aliases LCA Taxa Group Subgroup
ECFp109273
Rhizobium sp. AAP43 ECF293 ECF293s25

>ECFp109273 ECF293 ECF293s25 Rhizobium sp. AAP43

1 MLLDIEGDCFANGARAEAGGGVAQDEGDDLALARHLVDGDAAVFELLYRR
51 HNAAMIRFCAGIVRSRDIAEEVVQDTWVAVLGRIDLFEGRGSLASWIYTI
101 LLNKARSRARREGRIVSFDDLGDGNGLGEAFDGRGHWRTRPELWEDLTPE
151 RHIEGRSVLQHVEAVIETLPPAQRAVLILRGQQELDPAEVCALLDISEGN
201 MRVLLHRARLAVRNALDRLHAGL

Name Aliases LCA Taxa Group Subgroup
ECFp110517
Rhizobium sp. AAP43 ECF293 ECF293s25

>ECFp110517 ECF293 ECF293s25 Rhizobium sp. AAP43

1 MAQDEGDDLALARHLVDGDAAVFELLYRRHNAAMIRFCAGIVRSRDIAEE
51 VVQDTWVAVLGRIDLFEGRGSLASWIYTILLNKARSRARREGRIVSFDDL
101 GDGNGLGEAFDGRGHWRTRPELWEDLTPERHIEGRSVLQHVEAVIETLPP
151 AQRAVLILRGQQELDPAEVCALLDISEGNMRVLLHRARLAVRNALDRLHA
201 GL

>ECFp115258 ECF293 ECF293s25 Rhizobium sp. Leaf321

1 MAQVDGDDRALALRLVEGDAVAFELLYRRHNAAMIRLCNGIVRSRVIAED
51 VAQDTWVTVLDRIDLFEGRGSLASWIYTILINKARSRARREGRTVSFDDF
101 GVDGTLNDAFDGRGHWRTMPALWENLTPERHVEGRSVLQHVEAVIETLPQ
151 AQRAVLILRGQQELDPAEVCTLLDISEGNMRVLLHRARLTVRNALDRLNA
201 DP

Name Aliases LCA Taxa Group Subgroup
ECFp158637
Rhizobium sp. RU33A ECF293 ECF293s25

>ECFp158637 ECF293 ECF293s25 Rhizobium sp. RU33A

1 MTQVEGDDQALVLRLMDGDAAAFDLLYRRHNASMIRFGTGIVQHRHLAEE
51 VAQDTWIAVLGRIDLFEGRSSLASWIYTILINKARSRARREGRTVFFDDH
101 ASGDSLADAFDGRGHWRQIPELWENLTPERHIEGRSVLQHVEEVIDTLPP
151 TQRAVLILRGQQELDPSEVCALLNISEGNMRVLLHRARLAVRNALDRLNA
201 VG

Name Aliases LCA Taxa Group Subgroup
ECFp162055
Rhizobium sp. RU33A ECF293 ECF293s25

>ECFp162055 ECF293 ECF293s25 Rhizobium sp. RU33A

1 MDGDAAAFDLLYRRHNASMIRFGTGIVQHRHLAEEVAQDTWIAVLGRIDL
51 FEGRSSLASWIYTILINKARSRARREGRTVFFDDHASGDSLADAFDGRGH
101 WRQIPELWENLTPERHIEGRSVLQHVEEVIDTLPPTQRAVLILRGQQELD
151 PSEVCALLNISEGNMRVLLHRARLAVRNALDRLNAVG

Name Aliases LCA Taxa Group Subgroup
ECFp167898
Rhizobium sp. NFR12 ECF293 ECF293s25

>ECFp167898 ECF293 ECF293s25 Rhizobium sp. NFR12

1 MAQVDCDDRALALRLVEGDAAAFELLYRRHNAAMIRLCNGIVRSRVIAED
51 VAQDTWVTVLDRIDLFEGRGSLASWIYTILINKARSRARREGRTVSFDDF
101 GVDGTLNDAFDGRGHWRTMPALWENLTPERHVEGRSVLQNVEAVIETLPQ
151 AQRAVLILRGQQELDPAEVCTLLDISEGNMRVLLHRARLTVRNALDRLNA
201 DL

>ECFp39887 ECF293 ECF293s25 Agrobacterium sp. SCN 61-19

1 MTQVEGDDQALVLRLVDGDAAAFDVLYRRHNAAMIRFGIGIVQHRHLAEE
51 VVQDTWIAVLGRIDLFEGRSSLASWIYTILINKARSRARREGRTVFFDDH
101 ASGDSLADAFDGRGHWRQIPELWENLTPERHIEGRSVLQHVEEAIDTLPT
151 AQRAVLILRGQQELAPSEVCALLNISEGNMRVLLHRARLAVRNALDRLNA
201 AG

Name Aliases LCA Taxa Group Subgroup
ECFp40454
  • ECF subfamily RNA polymerase sigma-24 factor
  • QWE_04463
Agrobacterium albertimagni AOL15 ECF293 ECF293s25

>ECFp40454 ECF293 ECF293s25 Agrobacterium albertimagni AOL15

1 MAQVEGDDQALVLRLVDGDAAAFDVLYRRHNAAMIRFCTGIVQHRHLAEE
51 VVQDTWIAVLGRIDLFEGRSSLASWIYTILINKARSRARREGRTVFIDDH
101 ASGDSLADAFDGRGHWRQIPELWENLTPERHIEGRSVLQHVEEVIDTLPP
151 TQRAVLILRGQQELDPSEVCALLHISEGNMRVLLHRARLAVRNALDRLNA
201 AG

Name Aliases LCA Taxa Group Subgroup
ECFp42277
  • hypothetical protein
  • QWE_RS04450
Agrobacterium albertimagni AOL15 ECF293 ECF293s25

>ECFp42277 ECF293 ECF293s25 Agrobacterium albertimagni AOL15

1 MRLDFKDDCFANDRRIDVRGGVAQVEGDDQALVLRLVDGDAAAFDVLYRR
51 HNAAMIRFCTGIVQHRHLAEEVVQDTWIAVLGRIDLFEGRSSLASWIYTI
101 LINKARSRARREGRTVFIDDHASGDSLADAFDGRGHWRQIPELWENLTPE
151 RHIEGRSVLQHVEEVIDTLPPTQRAVLILRGQQELDPSEVCALLHISEGN
201 MRVLLHRARLAVRNALDRLNAAG

>ECFp77286 ECF293 ECF293s25 Agrobacterium sp. RAC06

1 MTQVEGDDQALVLRLVDGDAAAFDILYRRHNAALIRFCTGIVQHRHLAEE
51 VVQDTWIAVLGRIDLFEGRSSLASWIYTILINKARSRARREGRTVFFDNH
101 ASGDSLADAFDGRGHWRQIPELWENLTPERHIEGRSVLQHVEEVIDTLPP
151 AQRAVLILRGQQELDPSEVCALLNIGEGNMRVLLHRARLAVRNALDRLNA
201 AG

>ECFp90811 ECF293 ECF293s25 Rhizobium sp. Leaf306

1 MAQVDCDDRALALRLVEGDAAAFELLYRRHNAAMIRLCNGIVRSRVIAED
51 VAQDTWVTVLDRIDLFEGRGSLASWIYTILINKARSRARREGRTVSFDDF
101 GVDGTLNDAFDGRGHWRTMPALWENLTPERHVEGRSVLQHVEAVIETLPQ
151 AQRAVLILRGQQELDPAEVCTLLDISEGNMRVLLHRARLTVRNALDRLNA
201 DL

Name Aliases LCA Taxa Group Subgroup
ECFp93577
Rhizobium sp. AAP116 ECF293 ECF293s25

>ECFp93577 ECF293 ECF293s25 Rhizobium sp. AAP116

1 MEDNECDDAILLPRLVVGDRMAFQRLFRLHNAPMIRFATGIVRSRHVAEE
51 VVQDTWVSVLGRIDLFEGRSSLASWIYAILVNKARTVAKREGRIVFFDDA
101 GDGNGLADAFDGRGRWRDIPELWDELTPDRHVEGRSVLQHVEAAIEALPP
151 AQRAVLILRSQQELEAKEVCTLLGMSEGNMRVLLHRARVHVRNVLDRLNK
201 DL

Name Aliases LCA Taxa Group Subgroup
ECFp94757
  • hypothetical protein
  • AZF01_17975
  • ... more
Martelella sp. AD-3 ECF293 ECF293s25

>ECFp94757 ECF293 ECF293s25 Martelella sp. AD-3

1 MLVEGNQVAFEGLFRRHNAAMIRFCTGMVQSRQTAEEVVQDTWVSVLNRI
51 DLFEGRSSLASWIFTILINKARTRAKREGRVVLFDDQGDGDGLADAFDGR
101 GRWRTMPALWDDLTPERHVAGRSILQHVEAVIATLPPAQRAVLILRGQQE
151 LDPSEVCALLDISEGNMRVLLHRARVTLRNALDRLNKEA

Name Aliases LCA Taxa Group Subgroup
ECFp93174
  • DNA-directed RNA polymerase sigma-70 factor
  • Q321_RS0110790
Conchiformibius steedae DSM 2580 ECF293 ECF293s34

>ECFp93174 ECF293 ECF293s34 Conchiformibius steedae DSM 2580

1 MEQFQALLAAVRPEVLRFARVQLRDEDLAEDMVQEALVAAMDKHRQFRSD
51 SGLKTWVLAILKNKISDHFRSLKNMVSLDEWQEDNHAIEQNFDACFDERG
101 HWLAAAAPQAWDAEPETFTDQQEFRRALENCLRGLPEDTARIFYLREIMG
151 MEVEEICADFAISRENCYVILHRARNGLRACLQHRWFDWHQESGKAYVEL

>ECFp101781 ECF293 ECF293s34 Neisseria sp. oral taxon 020 str. F0370

1 MTRTDPQNFGGELAAMRPDILRFATVQLRDKTLAEDLVQETLAAAWDKQS
51 QFGGKSGLKTWVMAILKNKITDHFRSSRATLSLDSLQEENEAIDQAYRAC
101 FDADGHWLESASPAAWHEPESSIEQQDFFRILEHCMDGLPADTARIFYLR
151 EVMGMDVDEICREFAISKDNCYVILHRARNGLRRCLQMRWFDLPA

Name Aliases LCA Taxa Group Subgroup
ECFp103084
  • RNA polymerase subunit sigma-70
  • AKG43_05630
  • ... more
Neisseria sp. 74A18 ECF293 ECF293s34

>ECFp103084 ECF293 ECF293s34 Neisseria sp. 74A18

1 MENFKKVLASLRPDILRFAKIQLRDEYLAEDIVQETLATAIDKHSQFRGD
51 AGVKTWVMTILKNKITDYFRSAKHTVSLDALQEENAAIDNGYEDCFNDSG
101 HWLLSASPRQWSAAPEDAECQKAFFRTLENCLKGLPEDTARIFYLREIMG
151 MDIEEICSSFNITKDNCYVILHRARNGLRNCLQHRWFDLN

Name Aliases LCA Taxa Group Subgroup
ECFp105047
  • sigM
  • RNA polymerase sigma factor
  • ... more
Neisseria weaveri ECF293 ECF293s34

>ECFp105047 ECF293 ECF293s34 Neisseria weaveri

1 MTQTNDHWQRLAELHPTVLRFAKIQLRDDTLAEDIVQETFATALDKSAQF
51 REDASLKTWVLTILKNKITDYFRRKKYTVSLDEMQEDNAAIDNAYNGCFD
101 ETGHWITPLSPGEWQQAPEEHARRSDFFRTLENCMYGLPEDTARIFYLRE
151 IMGLEIGEICNQFNISKDNCYVILHRARNGLRNCLQHRWFDLNT

>ECFp105926 ECF293 ECF293s34 Neisseria elongata subsp. glycolytica

1 MTTPEQDTYGRLLAALRPGLLRFALIQLRDRAQAEDIVQETLAAAWGKLG
51 QFREEADLKTWVTAILKNKIADHFRSGRRTAVSLDSLREENEAADQAWHT
101 CFDAGGHWLETAAPAAWRPPEDYAEQQDFFRTLENCLGGLPEDTARIFYL
151 REIMGMEVEEICGRFGIGRDNCYVILHRARNSLRRCLQLRWFDIGA

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more