ECF proteins of ECF group ECF288

Displaying ECF 1 - 20 of 74 in total

>ECFp111727 ECF288 ECF288s1 Clostridiales bacterium VE202-08

1 MEKKNEQDLIQAAIQGDSAALEELLLSVRDQIFTLALRMLGSVADAEDAV
51 SEILIKVMCNLSAFRQESAFSTWVYRIAVNTLLTTRKSMFANQPLSFEIM
101 GQDIEAGYIEAAQKDTCGVEHEVLADELKLSCTNVMLQCLKPEDRCIFIL
151 GTMFKLDSQNAADILNISAENYRQRLSRSRKKVGGFLKQYCGLVNKDSCS
201 CQKRLGVAIKTHRLNPQHLEYSDHVKTENFIQNMEDLDEISDVYREEIRF
251 CSHIEIKEFLKKLLQSRQLNEVMNEGRETA

>ECFp113709 ECF288 ECF288s1 Robinsoniella sp. RHS

1 MENTTKNLYHDNSDTDYTNDEWNEFVDLAVSGDRSAMETLLVSIQDLIFN
51 LSLRMLGTIPDAEDAVQEITIRIMTHLETFRKESSFTTWAFRIAVNHLKN
101 YKKSMFAKRPLSFEFYGYDIKNGAANDIPDPAQNVEQPLLEQELKLSCTN
151 VMLQCLDPDSRCIFILGTMFKADSKIAGEILNITPEAYRQRLSRIRKKMA
201 AFLDEYCELGKQGFCRCRKRIPYAMETHRLNPQNLEYSSLEVLPEELLIS
251 CKNAMEQIDDLSLAFSSMPQYRTPENARTFFMNLLKTDCYAKIEKVN

>ECFp84246 ECF288 ECF288s1 Hungatella hathewayi 12489931

1 MQEPSYAKSEREEKDMNEKEQMETQKLVRLAAEGDKGALEQLLTGVQDLV
51 FNLSLRMLGTIHDAEDASQEILIRVMTNLASFRGESAFTTWVFRIAVNHL
101 KNYRKSMFAQHPLSFEYYGEDIVSGKEKDIPDLTMGVDRNLLEQELKLSC
151 TNVMLQCLDTDSRCIYILGTMFRVDSRLAAEILEISPEAYRQRLSRIKKK
201 MAGFLDEYCGLSGKGVCSCSKRISYAIATHRVNPEKPEFTGLEENTEFLQ
251 ECKTAMEEIDDRSLVFSSLPAYRTTRAARQYLNEFLKSDCYSMISNA

Name Aliases LCA Taxa Group Subgroup
ECFp149998
  • RNA polymerase subunit sigma-24
  • BN348_RS07845
Candidatus Soleaferrea massiliensis AP7 ECF288 ECF288s1

>ECFp149998 ECF288 ECF288s1 Candidatus Soleaferrea massiliensis AP7

1 MTDQLYEESKLIDQAIAGDKQSLEKLCAGVQDLVFSLSLRMLGSIHDAED
51 ASQEIMIRILTNLSSFRRESAFSTWVYSVAVNHLRNYQKGMFAHFPRSLE
101 FYGEDIRNPQTPDIPDPAQDVDTGLLAQELKLSCTNVMLQCLDTESRLIF
151 ILGTMFHLDSRIAGELLGLSPDAYRQRLSRIRRKMADFLQEYCELGGGVC
201 RCANRVPHAVACHRIDPDNLEFSALQEWDRRIADSKESMERLDELSIAFA
251 QMPVYRSPDKAKAFLREFLQANRCRILCDE

>ECFp162697 ECF288 ECF288s1 Eubacterium aggregans

1 MDYENEKMLIGNAALGDKKALETILYEVQDMVFNLSLRMLGHIPDAEDAA
51 QEILIKVMTRISSFKQESSLSTWVFRIAVNRLKNYQKGLFANRPLSFETY
101 GEDIASGRERDVPDMSGGVDQALLERELKLSCSNVMLQCLDKESRAIYIL
151 GTMFRLDSRIAAEIMEITPEAYRKRLSRIRQKMGDFLKAYCGLSGTGICS
201 CKRRIHYAILTHRIHPDHLDFGAMEVCAYKDIVAYTDAMEQLDDLSQIFA
251 DFPAYHASEQATAWIQKLMAGKDFSVVMQG

Name Aliases LCA Taxa Group Subgroup
ECFp79477
  • RNA polymerase subunit sigma-24
  • Sigma-70 region 2
  • ... more
Hungatella hathewayi DSM 13479 ECF288 ECF288s1

>ECFp79477 ECF288 ECF288s1 Hungatella hathewayi DSM 13479

1 MDEKKREDTEMLVSRAVEGDQEALEQLLTEVQDLVFNLSLRMLGTIQDAE
51 DASQEILIRVMTNLASFRGESAFSTWVFRIAVNHLKNYRKSMFARQPLSF
101 EYYGEDIVSGKEKDIPDLTMGVDRNLLEQELKLSCTNVMLQCLDADSRCI
151 YILGTMFRVDSRLAAEILDLSPEAYRQRLSRIRKKMAGFLEEYCGLSGKG
201 VCSCGKRVSYAIASHRVNPEKPEYTSLKENTEFLLECKTAMEEIDDLSMV
251 FSSLPAYRTTKAAREYLDEFLKSDCYSTISNAL

>ECFp110854 ECF288 ECF288s1 Clostridium hathewayi CAG:224

1 MDEKKREDTEMLVSRAVEGDQEALEQLLTEVQDLVFNLSLRMLGTIQDAE
51 DASQEILIRVMTNLASFRRESAFSTWVFRIAVNHLKNYRKSMFARQPLSF
101 EYYGEDIVSGKEKDIPDLTMGVDRNLLEQELKLSCTNVMLQCLDADSRCI
151 YILGTMFRVDSRLAAEILDLSPEAYRQRLSRIRKKMAGFLEEYCGLSGKG
201 VCSCGKRVSYAIASHRMNPEKPEYTSLKENTEFLLECKTAMEEIDDLSMV
251 FSSLPAYRTTKAAREYLDEFLKSDCYSTISNAL

Name Aliases LCA Taxa Group Subgroup
ECFp149609
Hungatella hathewayi ECF288 ECF288s1

>ECFp149609 ECF288 ECF288s1 Hungatella hathewayi

1 MQEPLYAKSEREEKDMNEKEQMETQKLVRLAAEGDKGALEQLLTGVQDLV
51 FNLSLRMLGTIHDAEDVSQEILIRVMTNLASFRGESAFTTWVFRIAVNHL
101 KNYRKSMFAQHPLSFEYYGEDIVSGKEKDIPDLTMGVDRNLLEQELKLSC
151 TNVMLQCLDTDSRCIYILGTMFHVDSRLAAEILEISPEAYRQRLSRIKKK
201 MAGFLDEYCGLSGKGVCSCSKRISYAIATHRVNPEKPEYTSLEENTEFLQ
251 ECKTAMEEIDDRSLVFSSLPAYRTTRAARQYLDEFLKSDCYSMISNA

>ECFp92329 ECF288 ECF288s1 Bariatricus massiliensis

1 MDKSTNKDLTDLIDKAIAGDEKSLETIILSVQDLVFNLSLRMLGTFPDAE
51 DASQEILLKVITHLSSFKKESAFSTWVFRIAANHLKDYKKNMFSQHPLSF
101 EYYGYDIENGGAEDIPDLTQNVEKAILAEELKLSCTNVMLQCLDTESRCI
151 FILGTMFKVDSRIAGEILGITPEAYRQRLVRVRRKMADFLEAYCGEFGGG
201 KCRCKDRLNYAIQSHRLHPAHLEYTSSKEVSTEEITGVKNAMEEIDDLAG
251 RFHFCKTYESPERTRRFIRDFLSSTQISIVNNLGTEGV

>ECFp90556 ECF288 ECF288s1 Clostridiales

1 MNNNRTEITPDAVEKAVSGDRKALEELLTGIQDPVFHLSLRMLGSIPDAE
51 DATQEILLKVMTHLSSFRGESAFTTWVFRIAVNHLKDYKKHMFANHPLSF
101 EYYGADIDSGKEKEIPALSPELDHDLLEQELKLSCTNVMLQCLDPESRCI
151 FILGTMFQADSRIAGDILDMTPENYRQKLSRARKKMSAFLKEYCGLTGGK
201 CACKRRIPYAAATHRIHPEAVEYSPLAVPNPDADEFVKHMEEIDDLSLLF
251 SSLPTFRATAEARKFLSDFLSSDRCSYIMNA

Name Aliases LCA Taxa Group Subgroup
ECFp104093
Enterococcus avium ECF288 ECF288s1

>ECFp104093 ECF288 ECF288s1 Enterococcus avium

1 MNIERETALIQSALSGDSNSLTKLLSEVKDSVFNLSLRMLGNIFDAEDAT
51 QEILLKIVMNLGSFKQQSRFSTWVYRIAVNHLITVQRKRSFQEQLTFELM
101 QKDLDQSLPTKESAFSDLEEDELAEELKLSCTNIMLQCLKPEDRCIFILG
151 TMFKMNSQLASGLLQITPETYRKKLSRARKRMGKFLENYCEHAGGKCDCK
201 RRVPFAIKQHRLNPNRLDYSSLKKFDLAEIQQQKENMEFMDNQTLLFEAL
251 SHYQSSFDPPKFLSKLLESKQLLELIKEDATYDL

>ECFp109822 ECF288 ECF288s1 Robinsoniella

1 MAVSGDRSAMETLLVSIQDLIFNLSLRMLGTIPDAEDAVQEITIRIMTHL
51 ETFRKESSFTTWAFRIAVNHLKNYKKSMFAKRPLSFEFYGYDIKNGAAND
101 IPDPAQNVEQPLLEQELKLSCTNVMLQCLDPDSRCIFILGTMFKADSKIA
151 GEILNITPEAYRQRLSRIRKKMAAFLDEYCELGKQGFCRCRKRIPYAMET
201 HRLNPQNLEYSSLEVLPEELLISCKNAMEQIDDLSLAFSSMPQYRTPENA
251 RTFFMNLLKTDCYAKIEKVN

Name Aliases LCA Taxa Group Subgroup
ECFp111822
  • RNA polymerase subunit sigma-24
  • rpoE_1
  • ... more
Lachnospiraceae ECF288 ECF288s1

>ECFp111822 ECF288 ECF288s1 Lachnospiraceae

1 MNNNRTEIAPDAVEKAVSGDRKALEELLTGIQDPVFHLSLRMLGSIPDAE
51 DATQEILLKVMTHLSSFRGESAFTTWVFRIAVNHLKDYKKHMFANHPLSF
101 EYYGADIDSGKEKEIPALSPELDHDLLEQELKLSCTNVMLQCLDPESRCI
151 FILGTMFQADSRIAGDILDMTPENYRQKLSRARKKMSAFLKEYCGLTGGK
201 CACKRRIPYAAATHRIHPEAVEYSPLAVPNPDADEFVKHMEEIDDLSLLF
251 SSLPTFRATAEARKFLSDFLSSDRCSYIMNA

Name Aliases LCA Taxa Group Subgroup
ECFp114848
Eisenbergiella tayi ECF288 ECF288s1

>ECFp114848 ECF288 ECF288s1 Eisenbergiella tayi

1 MNNNRTEITPDAVEKAVSGDRKALEELLTGIQDPVFHLSLRMLGSIPDAE
51 DATQEILLKVMTHLSSFRGESAFTTWVFRIAVNHLKDYKKHMFANHPLSF
101 EYYGADIDSGKEKEIPALSPELDHDLLEQELKLSCTNVMLQCLDPESRCI
151 FILGTMFQADSRIAGDILDMTPENYRQKLSRARKKMSAFLKEYCGLTGGK
201 CACKRRIPYAAATHRIHPEAVEYSPLAVPNPDANEFVKHMEEIDDLSLLF
251 SSLPTFRATAEARKFLSDFLSSDRCSYIMNA

>ECFp114885 ECF288 ECF288s1 Hungatella hathewayi

1 MNEKEQMETQKLVRLAAEGDKGALEQLLTGVQDLVFNLSLRMLGTIHDAE
51 DASQEILIRVMTNLASFRGESAFTTWVFRIAVNHLKNYRKSMFAQHPLSF
101 EYYGEDIVSGKEKDIPDLTMGVDRNLLEQELKLSCTNVMLQCLDTDSRCI
151 YILGTMFRVDSRLAAEILEISPEAYRQRLARIKKKMAGFLDEYCGLSGKG
201 VCSCSKRISYAIATHRVNPEKPEYTSLEENTEFLQECKTAMEEIDDRSLV
251 FSSLPAYRTTRAARQYLNEFLKSDCYSMISNA

>ECFp147225 ECF288 ECF288s1 Candidatus Stoquefichus sp. SB1

1 MDKEELFHEIDKAIAGNEEALETLILSVQDLVFNLSLRMLGTFHDAQDAT
51 QEILLKVITHLSSFRKESAFSTWVFRIAVNHLKNYKKSMFALQPLSFEFY
101 AQDIEHPQAHDIPDLSQDIEKALLADELKMSCTNVLLQCLDTESRCIFIL
151 GTMFKLDSRIAGEILEMTPAAYRQKLSRTRKKVSQFLKEYCGAYGHGNCC
201 CESRIDYAILTQRLNPQNLEYTTALANNQTLLDVKNAMEEVDDLATDFRF
251 LKIYQSPEKTKDFIQKLLKSDSLSTIQNSKMEE

>ECFp149479 ECF288 ECF288s1 Anaeromassilibacillus senegalensis

1 MSKKMQQTEKEIIEKALSGDQKALESILSGIQDMAFNLSLRMLGTVPDAE
51 DAAQEILIKVMTRLSAFRGDSSLSTWAFRIAVNHLRDYRKHMFAQRPLSF
101 EAYGADIASGREKDVPDLSGGVDEALLERELKLSCTNVMLQCLDAESRCI
151 FILGTMFRLNSQAAAEILEITPEAYRQRLSRIRKRMAAFLAEYCGLSGTG
201 MCDCRKRIHYAIASHRIRPDCLEFQKLDACGYDAICSFTDAMEEIDGLSQ
251 IFADFPAYRCPEEAAARMRELMASKSFAEVLHE

>ECFp149761 ECF288 ECF288s1 uncultured Anaerotruncus sp.

1 MMSTTHEKQLLAAAVAGDEQALEQVLHSVQDMVFNLSLRMLGTIPDAEDA
51 AQEILIKVMTHLSSFRGDSALSTWVYRIAVNHLTSCQKGMFKDHPLSFEE
101 YGADILSDRAHGLPDLSGGVDRALLAHELKLSCTCVMLQCLDVPSRAVYI
151 LGTMFGLDSRTAAQILGTTPQAYRQKLSRTRKKMAAFLGAYCGLGGGPCR
201 CADRVDYAVASHRIDPQDPGFCALHPASPQATAHTGAMEELDALSQVFAD
251 LPHYRSTQQVSDWVHQLVRSKSFRTAVNGQGGDA

Name Aliases LCA Taxa Group Subgroup
ECFp152589
Hungatella hathewayi ECF288 ECF288s1

>ECFp152589 ECF288 ECF288s1 Hungatella hathewayi

1 MDEKKREDTEMLVSRAVEGDQEALEQLLTEVQDLVFNLSLRMLGTIQDAE
51 DASQEILIRVMTKLASFRGESAFSTWVFRIAVNHLKNYRKSMFARQPLSF
101 EYYGEDIVSGKEKDIPDLTMGVDRNLLEQELKLSCTNVMLQCLDADSRCI
151 YILGTMFRVDSRLAAEILDLSPEAYRQRLSRIRKKMAGFLEEYCGLSGKG
201 VCSCGKRVSYAIASHRVNPEKPEYTSLKENTEFLLECKTAMEEIDDLSMV
251 FSSLPAYRTTKAAREYLDEFLKSDCYSTISNAL

Name Aliases LCA Taxa Group Subgroup
ECFp161260
Eubacterium barkeri ECF288 ECF288s1

>ECFp161260 ECF288 ECF288s1 Eubacterium barkeri

1 MDYENEKRLIEKAALEDKKALEAILCEVQDMVFNLSLRMLGHIPDAEDAA
51 QEILIKVMTRISSFRQESSLSTWVFRIAVNHLKSYQKGLFANRPLSFEAY
101 GEDIASGRERDVPDMSGGVDHALLERELKLSCSNVMLQCLDKESRAIYIL
151 GTMFRLDSRIAAEIMEITPEAYRKRLSRIRQKMGNFLKAYCGLSETGICS
201 CKRRIHYAVLTQRLHPDHLDFMGMEACAYEDIVSCTDAMEQLDDLSQIFA
251 DFPAYHAPEQATAWIQKLMTGKDFSAVMQG

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more