ECF proteins of ECF group ECF287

Displaying ECF 1 - 20 of 55 in total

>ECFp109317 ECF287 ECF287s1 Corynebacteriales

1 MSVDGPDERAAETALVDRAVAGDRTAIADVVRLLQDPLYRLALRMTGNPP
51 DAEDAVQEILLRAVGNLASWRGEAKLTTWAYRIGVNYLLNQRRRSPQESA
101 QLDLDGFAANLLEGLAEQEYRGPEATVLTREVRLVCSQAMLQCLARDERV
151 AFVLADVFELSSAEAAWILGIGAPAYRKRLERARTRLGNFLNATCGVANP
201 AAPCRCARRVRTAVDQGRVRPGARGLGGHPVAPGGRSAADAEKQMIGLHD
251 AASILRAHPDYALPPARLDAIAKLLDSGRFPLLDR

>ECFp108222 ECF287 ECF287s1 Nocardia mexicana NBRC 108244

1 MDSDIAEAADGTARAAELELVARAVAGDQAAISRVVRSVQDPLYRLALRM
51 TGRPTEAEDATQEILLRVLGRLDTWRAEAKLLTWAYRIGVNYLINLRRQS
101 PQERAELDLDKFADGLTNGLSAEDYRGPDAALLSGEVRLNCSQAMLQCLA
151 RDERVAFVLGDVFELNSAEAAWILDVTPAAYRKRLERAKKRIGDFLNSNC
201 GIANPKARCRCSRRVDTAVARGRVDPRNPAFSTHPVTAGGRTATAAEEQM
251 IRLHDAASVLRVHPDYAAPQAKMQAITRLLGSGRFPLLE

>ECFp78136 ECF287 ECF287s1 Nocardia altamirensis NBRC 108246

1 MSVDAVASEQILAEERELVGRAVAGDRAAIADVVRLLQDPLYRLALRMVW
51 RPAEAEDATQEILLRVLGHLGTWRAEARLTTWAYRIGVNYLLNLKRQTPQ
101 EAAQLSLDTYREGLADGLAEEDYRGPEATLLATEVRLNCSQAMLQCLARD
151 ERVAFVLGDVFEMNSTDAAWILDITPAAYRKRLERAKKRLGTFLTSTCGL
201 ADSKAFCRCSRRIDKAVELGRVDPRKPTFARHPVTPGGRTAVKAEEQMIQ
251 LHDAAAVLRAHPDYAAPQAKMDAIAGLLNSGRFPLLD

>ECFp77385 ECF287 ECF287s1 Nocardia acidivorans NBRC 108247

1 METDSELSAEAGHGPDAQEVALVARALDGDRAAISEVILLLQDPIYRLAL
51 RMVWRPADAEDATQEILLRVVGKLGTWRGEAKLLTWAYRVGVNYLLNLKR
101 RTPQETTELSLDSYSEGLKDGLAEADYRGPEPELLTHETRLNCTQAMLQC
151 LAREERIAFVLADIFELSSTEAAWITGTTPAAYRKRLERAKKRLGNFLTS
201 TCGLANPKAFCRCARRVDKALELGRIDPDRPAFAAHRITPGGRGVAAAAQ
251 QMSSLRDAAAVLGAHPDYAAPQAKMDAIAGLITSGRFPLLD

>ECFp77445 ECF287 ECF287s1 Nocardia miyunensis NBRC 108239

1 MEPAAAPFTQEPAPGEADLVARAVAGDAAAVTEVVRLLQDPLYRLALRMT
51 GRPPDAEDATQEILLRVLGSLSTWRGEARLLTWAYRIGVNHLLNLRRRSP
101 QERVQLSLDEFATDLRDGLAEQDHRGPEATLLTREVRLTCSQAMLQCLSR
151 DERVAFVLSDVFELGSSEAAWILDTTPAAYRKRLQRAKKRLGDFLNSTCG
201 LTNPKAPCRCARRVDKAVEIGRIDPRRPVLAAHPVTPGGRTAAAAEQQMV
251 RLHDVAAVFRAHPDYAAPSARRDAVAALLDSDRFPMLNRPHD

Name Aliases LCA Taxa Group Subgroup
ECFp80649
  • DNA-directed RNA polymerase sigma-70 factor
  • ON37_RS24890
Nocardia veterana NBRC 100344 ECF287 ECF287s1

>ECFp80649 ECF287 ECF287s1 Nocardia veterana NBRC 100344

1 MTADPTDDRAAETALVERAVAGDRTAVTEVVRSLQDPLYRLALRMVGTPA
51 DAEDAVQEILLRVVGNLASWRGEAKLTTWAYRIGVNYLLNLRRRSPQEAA
101 RLDFDGFGADLLDGLAEQDYRGPEATVLTREVRLVCSQAMLQCLARDERV
151 AFVLADVFELTSSEAAWVLGIEAATYRKRLERARTRLGNFLNATCGVANP
201 AAPCRCARRVRPALDRGRVAVARPGLAAHPVSPGGRTAEQAEAQMIGLHD
251 AASVLRAHPDYALPPARLDAIAKLLESGRFSLLDR

>ECFp80782 ECF287 ECF287s1 Nocardia xishanensis NBRC 101358

1 MSSADTPAVDPGQDAAADVRRAEAALVARAVDGDRDAIAEIVRMLQDPLY
51 RLALRMVGRPAEAEDATQEILIRAVTRLATFRGEAKLLTWAYRIGVNYLI
101 NLRTRSPQEQRELSLEEFGAGLTDGLAAEDYQGPRAALLSSEVRLNCSQG
151 MLQCLAREERVAFVLGQVFELGSAEAAWILDITPAAYRKRLERAKKRLGA
201 FLGSACGVADPRAACRCSRRVEKAVALGRVDPAAPRYATHPVSPGGRTVL
251 EAEEQMIRLHDVAAVLRGHPDYAAPSERMDAIATLLRSGQFPLLA

>ECFp88203 ECF287 ECF287s1 Nocardia kruczakiae NBRC 101016

1 MSVDDADERVAETALVDRAVAGDRTAVTEVVRLLQDPLYRLALRMTGNPS
51 DAEDAVQEILLRAVGNLASWRGEAKLTTWAYRIGVNYLLNQRRRSPQESA
101 HLDLDGFGANLLEGLAEQDYRGPEATVLTREVRLVCSQAMLQCLARDERV
151 AFVLADVFELSSAEAAWILGIGAPAYRKRLERARTRLGNFLDSTCGVANP
201 AAPCRCSRRVRTAVDQGRVRPGRPGLGGHPVTPGGRSAADAEAQMAGLHD
251 AASILRAHPDYALPPARLEAIATLLDSGRFPLLDR

Name Aliases LCA Taxa Group Subgroup
ECFp98997
  • RNA polymerase subunit sigma-70
  • ON41_RS30110
Nocardia transvalensis NBRC 15921 ECF287 ECF287s1

>ECFp98997 ECF287 ECF287s1 Nocardia transvalensis NBRC 15921

1 MTVEPAAGPEGDAAADGALAARAAAGDRDAVTEIVRLLQDPLYRLALRMT
51 GRPADAEDAVQEILLRVLGHLGTFRGEARLLTWAYRIGVNFLLNQRRRSP
101 QEAAQLSLDDFGAGLRDGLAAEDHRGPEATVLTREVRLSCSQGMLQCLSR
151 EERVAFVLGDVFELSSAEAAWILDTTPAAYRKRLERAKKRLGNFLNSACG
201 LANPQAFCRCARRVDKAVHLGRVDPAHPVLATHPVTPGGRTAAAAESQMV
251 RLHDAAAVFRAHPDYAAPQARVDAIARLLESGRFPLLGEPPR

Name Aliases LCA Taxa Group Subgroup
ECFp105350
  • putative RNA polymerase ECF-type sigma factor
  • RNA polymerase subunit sigma-70
  • ... more
Nocardia cyriacigeorgica GUH-2 ECF287 ECF287s1

>ECFp105350 ECF287 ECF287s1 Nocardia cyriacigeorgica GUH-2

1 MTIDAPTAPEPSEVALVAQAVDGNPDAVARILRDLQDPIYRLALRMTGRP
51 ADAEDATQEILLRVFTRLAMWRGEAKLLTWAYRIGVNHLLNQRRRSPQEA
101 AQLSLDAFGDKLTEDLATDYPGPDAELLATEVRLQCSQAMLQCLSREERV
151 AFVLDDVFGVGSTEASWILDITPTAYRKRLERAKKRLRTFLTSACGIASE
201 QARCRCARRVDYAISTGRINPQHPELATHPVSAGAATAELQMIALHDAAA
251 IFRAHPDYALPDAKRNAVADLLRSGRFPLLADHTG

Name Aliases LCA Taxa Group Subgroup
ECFp100176
  • DNA-directed RNA polymerase sigma-70 factor
  • ON40_RS31565
Nocardia jiangxiensis NBRC 101359 ECF287 ECF287s1

>ECFp100176 ECF287 ECF287s1 Nocardia jiangxiensis NBRC 101359

1 MGSAAAPFTQEPVPGEADLVARAVAGDAAAVTEVVRLLQDPLYRLALRMT
51 GRPPDGEDATQEILLRVLDNLSTWRAEARLLTWAYRIGVNHLLNLRRRSP
101 QERAQLSLDEFATDLRDGLAEQDHRGPEATLLTREVRLTCSQAMLQCLSR
151 DERVAFVLSEVFEFDSSAAAWILGTTPVAYRKRLQRAKKRLGDFLNSTCG
201 LANPKAACRCARRVDKAVELGRVDPRRPAYATHSITPGGRTAAAAEQQMV
251 GLHDAAAVLRAHPDYAAPEVRRDVVAALLDSGRFPMLEPPRD

>ECFp101542 ECF287 ECF287s1 Nocardia mikamii NBRC 108933

1 MSVDDADERMAETALVDRAVAGDRSAVTEVVRLLQDPLYRLALRMTGNPS
51 DAEDAVQEILLRAVGNLASWRGEAKLTTWAYRIGVNYLLNQRRRSPQESA
101 RLDLDGFGANLLAGLAEQDYRGPEATVLTREVRLVCSQAMLQCLARDERV
151 AFVLADVFELSSAEAAWILGIGAAAYRKRLERARTRLGNFLNATCGVANP
201 AAPCRCSRRVRTAVDQGRVRPGRPVLAGHRVTPGGRSAADAEAQMAGLHD
251 AASILRAHPDYAMPPARLEAIATLLDSGRFPLLDR

>ECFp101696 ECF287 ECF287s1 Nocardia vaccinii NBRC 15922

1 MESAAEPFTHEPVPGEADLVARAVAGDRAAVTEVIRLLQDPLYRLALRMT
51 GRPADAEDATQEILLRVVGNLGTWRAEARLLTWSYRIGVNYLTNLRRRSP
101 QERVQLSLDEFATGLRDGLAEQDYRGPEAAVLTREVRLSCSQGMLQCLSR
151 DERVAFVLHDVFELGSAEAAWILGTSPAAFRKRAERARKRLGAFLNSTCG
201 VVNPKAPCRCARRVGKAVELGRVDPRRPALAAHPVTPGGRTAAAAEQQMV
251 HLHDAAAVFRAHPDYAAPEARRDAVAALLDSGRFPMLDRPHD

>ECFp104839 ECF287 ECF287s1 Nocardia cerradoensis NBRC 101014

1 MSVDDADERVAETALVDRAVAGDRSAVTEVVRLLQDPLYRLALRMTGNPS
51 DAEDAVQEILLRAVGNLASWRGEAKLTTWAYRIGVNHLLNQRRRSPQESA
101 HLDLDGFGANLLEGLAEQDYRGPEATVLTREVRLVCSQAMLQCLARDERV
151 AFVLADVFELSSAEAAWILGIGAAAYRKRLERARTRLGNFLDSTCGVANP
201 AAPCRCSRRVRTAVDQGRVRPGRPGLAGHPVTPGGRSAADAEAQMAGLHD
251 AASILRAHPDYALPPARLAAIASLLDSGRFPLLDR

Name Aliases LCA Taxa Group Subgroup
ECFp106752
  • RNA polymerase subunit sigma-70
  • ON30_RS26095
Nocardia takedensis NBRC 100417 ECF287 ECF287s1

>ECFp106752 ECF287 ECF287s1 Nocardia takedensis NBRC 100417

1 MTAAIDGDAVAATEIMRGLQDPIYRLALRMTGRPADAEDATQEILLRVFT
51 RLATWRGEAKLLTWAYRIAVNHLLNTRRRSPQEAAQLSLDAFGDLLVEGL
101 TADHRGPEAELLATEVRLQCSQAMLQCLTREERIAFVLDDVFDVRSADAA
151 WILDLTPAAYRKRLERTRKRLRTFLTSTCGYASAQARCRCSRRIAQAVSA
201 GRIDPRRPELSTHPVPGAGRSAAEAEQQMIALHDAAAVLRIHPDYAFPRA
251 KADAVAGLLRSGRFSLLSDASE

>ECFp111552 ECF287 ECF287s1 Nocardia jejuensis NBRC 103114

1 MTSERLGPDAGEVELVARAVAGDRAAVSDVVRLLQDPIYRLALRMVWRPA
51 DAEDASQEILLRVVAHLGTWRGEAKLLTWAYRLGVNYLLNLRRRTPQEAQ
101 QLSLDEFGEGLRDGLADADFRGPESELLTHEVRLNCSQAMLQCLAREERV
151 AFVLSEIFDLGSAEAAWVAGVTPAAYRKRLERAKRRLGNFLTSTCGLANP
201 KAFCRCARRVGKAVELGRVDVRRPAFATHPITPGGRSAAEAERQMIRLRD
251 AATVLGAHPDYAAPQAKMEAIAGILASGRFPMLG

>ECFp111959 ECF287 ECF287s1 Nocardia brasiliensis NBRC 14402

1 MGVQEQSQDGTRAAEQELVERAVAGDRDAITEVVRLLQDPLYRLALRMVG
51 RPAEAEDATQEILLRVLGNLATWRAEAGLRTWAYRVGVNYLLNLRRRTPQ
101 EAAQLSLDTFREGLADGLAEQDYRGPEATLLVTELRLNCSQAMLQCLARD
151 ERVAFVLGDVFELGSAEAAWVLDITPAAYRKRLARAKKRLGAFLSASCGW
201 ADPAAFCRCTRRVEQAVALGRIDPSRPNFARHPVTPGGRTADQAEQQMIQ
251 LHDAAAVLRAHPDYAAPQAKMDVIGELLRSGRYSLLQ

Name Aliases LCA Taxa Group Subgroup
ECFp114550
Nocardia arizonensis ECF287 ECF287s1

>ECFp114550 ECF287 ECF287s1 Nocardia arizonensis

1 MALVARAVRGDAAAVTEVVRALQTPVYRLALRMTGRPADAEDATQEILLR
51 ALTRLATWRAEATLLTWAYRIGVNHLLDAARKSPQEIANLSLDEFGEGLV
101 EGQASADYRGTDAALLAAEVRLRCSQAMLQCLTRAERVVFVLHDVFEMPS
151 ADAAWILDTTPAAYRKRWERVRGRMAAFLTATCGRVDAGASCRCSRRVAN
201 AIDLGRIDPRRPGLATHPVTANGRDVEAVEQQMSRLHDAAAIFRLHPDYA
251 APEITRGAISELLRSGRFPMFD

>ECFp107837 ECF287 ECF287s1 Nocardia aobensis NBRC 100429

1 MSVDDADERVAETALVDRAVAGDRSAVTEVVRLLQDPLYRLALRMTGNPS
51 DAEDAVQEILLRAVGNLASWRGEAKLTTWAYRIGVNYLLNQRRRSPQESA
101 LLDLDGFGANLLEGLAEQEYRGPEATVLTREVRLVCSQAMLQCLARDERV
151 AFVLADVFELSSAEAAWILGIGAAAYRKRLERARTRLGNFLDSTCGVANP
201 AAPCRCSRRVRTAVDQGRVRPGRPGLAGHPVTPGGRSAADAEAQMAGLHD
251 AASILRAHPDYALPPARLDAIATLLDSGRFPLLDR

>ECFp78276 ECF287 ECF287s1 Nocardia xishanensis NBRC 101358

1 MTGPDPEELRLVARAVDGDQAALREVIGRLQDPLYRLALRMVGRPPDAED
51 AVQEILLRVVTRLSTWRGEAKLLTWAYRVGVNYLLNLRRRSPQEQEQIGL
101 DDFRADLADGLAAADYQGPEAALLAEEVRLSCTQGMLQCLGREERVVFVL
151 GEIFELKAAEAAWILGTTPAACQKRLERVKQRLGTFLRSTCGVVEPKALC
201 RCPRRVGKARALGRVDLDNPAFTAHPVSPGGRGVAEAAAQIHRLRDAAAV
251 LRAHPDYAAPQAKIDAITGLLTSGRFPLLE

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more