ECF proteins of ECF group ECF245

Displaying ECF 1 - 20 of 673 in total
Name Aliases LCA Taxa Group Subgroup
ECFp37265
  • RNA polymerase sigma factor SigW
  • JCM9140_3498
  • ... more
Bacillus wakoensis JCM 9140 ECF245 ECF245s3

>ECFp37265 ECF245 ECF245s3 Bacillus wakoensis JCM 9140

1 MDTIVKRLIREVKKGEQQAFSEIVDLYKDKVYQVAYRMVGNVHEAQDIAQ
51 EAFLRAYTNIDRFDLNRKFSTWLFRIATNVAIDRLRKKKPDFYLQEEVGG
101 SDGLTFESQLAADEDLPEDQVITIEMQHWVQEEINQLPPKYRTAIILKYI
151 EDLSIKEISEILDIPQATVKTRIHRGREALRKRMRHV

Name Aliases LCA Taxa Group Subgroup
ECFp37325
  • RNA polymerase sigma factor SigW
  • AB986_18170
Anaerobacillus macyae ECF245 ECF245s3

>ECFp37325 ECF245 ECF245s3 Anaerobacillus macyae

1 MDAIVKRIILQVRKGDHNAFGELVELYKDRVFALSYRMLGNRQEAEDVAQ
51 EAFIRAYTNIDRYQIDRKFSTWLYRIATNLSIDRMRKKKPDYYLDAEVAG
101 TDGLTMYSQVSADEQLPEDEVVSLEAQDGIHRAILSLPAKYRSAITLKYI
151 QELSLKEISEILDLPIGTVKTRIHRGREALRKKLQEQ

>ECFp37556 ECF245 ECF245s3 Planococcus plakortidis

1 MDALVNKRIKRVMKGDQDAFAEIVELYQHQLFQICYRMLGNRHEAEDIAQ
51 EAFTRAYVNIHTFDQKRKFSTWLYRIATNLCIDRIRKKKPDYHLDAEVKG
101 TEGLNMYSKIANDDELPEEELMRMEVQERVQYEISRLPDKYRAAIVLKYI
151 EELPLAEISEILDLPLGTVKTRIHRGREALRKQLSNL

>ECFp37681 ECF245 ECF245s3 Paraliobacillus sp. PM-2

1 MIGNTHEAEDLAQEAFIRAFVNIHSYDDKRKFSTWLFRIATNVTIDRIRK
51 KKPDFYLDGEVKGTDGLTMYSQLAKEQPLPEEEVESLELQSYIQQQIMSL
101 PTKYRSVIALRFVDELSLAEISEILDIPIGTVKTRIYRGREALRKKLRHV

>ECFp37698 ECF245 ECF245s3 Planococcus maritimus

1 MDALVNKRIKRVMKGDQDAFAEIVELYQHQLFQICYRMLGNRHEAEDIAQ
51 EAFTRAYVNIHTFDQNRKFSTWLYRIATNLCIDRIRKKKPDYHLDAEVRG
101 TEGLNMYSKIANEEELPEEELMRMEVQERVQYEISRLPDKYRAAIVLKYI
151 EELPLAEISEILDLPLGTVKTRIHRGREALRKQLSNL

Name Aliases LCA Taxa Group Subgroup
ECFp39242
Bacillus okhensis ECF245 ECF245s3

>ECFp39242 ECF245 ECF245s3 Bacillus okhensis

1 MDTIVKRLIREVRKGDQQAFAEIVELYKDKVYQVAYRMVGNVHEAQDVAQ
51 EAFLRAYTNIERFDVNRKFSTWLFRIATNVAIDRLRKKKPDFYLQDEVKG
101 SEGLTFESQLAADEERPEDQVITIEMQEWVQDEINQLPPKYRTAIILKYM
151 EDLSISEISDILDIPQSTVKTRVHRGREALRKRMRHV

>ECFp119194 ECF245 ECF245s3 Bacillus sp. JCM 19041

1 MDSLTKRLIKEIKQGDEQAFAELVDLYKDKVYQVAYRMVGHAQEAQDVAQ
51 EAFLRAYTNLDKYDTTRKFSTWLFRIATNVAIDRLRKRKPDFYLQETVKG
101 TENMTYESQLAATDDLPEEQVVQMELQEWIQSEINELPPKYRTAIILKYI
151 EDLSLKEISEIMDMPVATVKTRIHRGREALRKRMRHV

>ECFp141082 ECF245 ECF245s3 Anaerobacillus isosaccharinicus

1 MDTLVKRLIKDVKKGDQQAFGELVELYKDKVYQISFRMVGNVHEAQDIAQ
51 EAFLRAYMNIETYDTERKFSTWLFRIVTNLSIDRLRKKKPDFYLDQEIGG
101 TEGLTLSSQIAATEELPEDLVITHELQDWIQGEILKLPTKYRSAIILKYI
151 EDLSLKEISEVLDLPIATVKTRIHRGREALRKRLSNV

>ECFp141603 ECF245 ECF245s3 Bacillus mediterraneensis

1 METIVKRRIKQMIKGDQNAYEEIVELYRDKVFQLCYRMLGDRYEAEDIAQ
51 EAFIRAYINIKSFNQNLKFSSWIYRIATNLCIDRIRKKKPDYYLDAEVPG
101 TEGLNMYSQVSADTARPEVELESLELRDEVQKQIAMLPEKYRSAIVLKYI
151 EELSLNEISEILDLPLGTVKTRIHRGREALRQQLKNV

>ECFp158760 ECF245 ECF245s3 Paenibacillus

1 MNHMDTRLAKLARGGDRAAFAELVELYKDKIFHLAYRMLHNRHEAEEIVQ
51 ETFLRVYTNLERYDDQQKFSTWIYRIGTNLCIDRLRKRKISYSLDAEMSD
101 GEGGSDWYATLASQDRTPDQQVALSETQAQIRESIDALPEKYKAVVILRY
151 LQDLSLQEISDALSMPVTTIKTRLHRGREYLRKKLEQLL

Name Aliases LCA Taxa Group Subgroup
ECFp158873
Marinococcus luteus ECF245 ECF245s3

>ECFp158873 ECF245 ECF245s3 Marinococcus luteus

1 MDATVKRLVKEVKKDGDQDAFRELVDLYKDKVYQIAYRMVGNAYEAQDMA
51 QEAFLRAYANIESYDEKRKFSTWLFRITTNLCIDRLRKKKPDYSLDAEIP
101 GADGLDGYSQLSSPDKLPDEQVVTMEMQEWVQEGILKLPPKYRTAIVLRY
151 IEDLSIQEISEILDLPENTVKTHVHRGREALRKHLGNT

Name Aliases LCA Taxa Group Subgroup
ECFp36157
  • RNA polymerase, sigma subunit, SigW
  • SAMN04487975_12314
Planomicrobium glaciei ECF245 ECF245s3

>ECFp36157 ECF245 ECF245s3 Planomicrobium glaciei

1 MDALVNKRIKKVLKGDQNAFAELVELYQHQLYQICYRMLGNKHEAEDIAQ
51 EAFTRAYVNLHTFDQKRKFSTWLYRIATNLCIDRIRKKKPDYYLDAEVRG
101 TEGLNMYSSIANDDQLPEEELMRMEVQERVQYEISRLPDKYRAAIVLKYI
151 EELPLSEISEILDLPLGTVKTRIHRGREALRKQLSNL

Name Aliases LCA Taxa Group Subgroup
ECFp38036
  • RNA polymerase sigma factor SigW
  • J416_02459
  • ... more
Gracilibacillus halophilus YIM-C55.5 ECF245 ECF245s3

>ECFp38036 ECF245 ECF245s3 Gracilibacillus halophilus YIM-C55.5

1 MIGNRHEAEDLAQEAFLRAYVNIHSYDEKRKFSTWLYRIATNLSIDRIRK
51 KKPDVYLDAEIKGTDGINLYAQIPNDEALPEQQVESLEMQTLIQEEIMSL
101 PPKYRSVIALRFMDELSLKEISEILQLPVGTIKTRIHRGREALRKKLRHI

>ECFp42544 ECF245 ECF245s3 Bacillus krulwichiae NBRC 102362

1 MDIIVKRLIREVRKGNQQAFSEIVELYKDKVFQVAYRMVGNMHEAQDVAQ
51 EAFLRAYTNIDRFDINRKFSTWLFRIATNVAIDRLRKKKPDFYLQEEVKG
101 SEGLTYESQLAASDDLPDDQVVALERQQWVQAEINQLPPKYRTAIILKYI
151 EDLSINEISEILDIPPSTVKTRIHRGREALRKRMRHV

Name Aliases LCA Taxa Group Subgroup
ECFp42902
Bacillus beveridgei ECF245 ECF245s3

>ECFp42902 ECF245 ECF245s3 Bacillus beveridgei

1 MDMLVKKLVLEVRKGNQKAYEELVDLYKDQVYHIAYRMLGNMHEAQDISQ
51 EAFLRAYMNIDSYDIDRKFSTWLFRITTNLTIDRIRKRKPDFHLEDPIAG
101 TDGMDHHARFVADMPLPEDQVVQLEQQEWIQKEILALPPKYRAAIVLKYI
151 EDKSLKEISEILNMPVGTVKTRIHRGREALKKRLSSS

Name Aliases LCA Taxa Group Subgroup
ECFp44976
  • RNA polymerase sigma factor SigW
  • G548_RS0111410
Marinococcus halotolerans DSM 16375 ECF245 ECF245s3

>ECFp44976 ECF245 ECF245s3 Marinococcus halotolerans DSM 16375

1 MDATVKRLVKEVKKDGDQDAFRELVDLYKDKVYQIAYRMVGNAYEAQDMA
51 QEAFLRAYANIESYDENRKFSTWLFRITTNLCIDRLRKKKPDYSLDAEIP
101 GAEGLDGYSQLSSPDKLPDEQVVTMEMQEWVQEGILKLPPKYRTAIVLRY
151 IEDLSIQEISDILELPENTVKTHVHRGREALRKHLGNT

Name Aliases LCA Taxa Group Subgroup
ECFp45020
  • RNA polymerase sigma factor SigW
  • RNA polymerase, sigma-24 subunit, ECF subfamily
  • ... more
[Bacillus] selenitireducens MLS10 ECF245 ECF245s3

>ECFp45020 ECF245 ECF245s3 [Bacillus] selenitireducens MLS10

1 MDMLVKKLVLEVRKGNQEAYAELVDLYKDQVYHIAYRMLGNMHESQDIAQ
51 EAFLRAYMNLDSYDINRKFSTWLFRITTNLTIDRIRKRKPDFHLEDPLAG
101 TDGMDHHAHFAAEMPLPEEQVVQLEQQEWIQKEIMALPPKYRSAIILKYL
151 EDKSLKEISEILNLPVGTVKTRIHRGREALKKRLGSS

>ECFp39260 ECF245 ECF245s3 Planococcus rifietoensis

1 MDALVNKRIKRVMKGDQDAFAEIVELYQHQLFQICYRMLGNRHEAEDIAQ
51 EAFTRAYVNIHTFDQNRKFSTWLYRIATNLCIDRIRKKKPDYHLDAEVKG
101 TEGLNMYSKIANEEELPEEELMRMEVQERVQYEISRLPDKYRAAIVLKYI
151 EELPLAEISEILDLPLGTVKTRIHRGREALRKQLSNL

>ECFp39687 ECF245 ECF245s2 Exiguobacterium chiriqhucha

1 MERLTTRLVDELRSGNHDSFAELVELYKDGVFAVAYKILYDRGEAEDAAQ
51 ETFIRAYTRIDTYDPQYKFKTWIYRIATNVAIDRLRKRKPEYSMDAEIAG
101 TDGLTYQDHLADEAPQPDAQVVHREIRGEMHEAIKQLPDKYRIPLLLKYV
151 DDLSLKEISVMIDMPVATVKTRIFRGREMLKTIFQNREGFN

>ECFp140820 ECF245 ECF245s2 Paenibacillus sp. UNC496MF

1 MISVEARLARLALQGDQRAFAEIVELYQDKLYHMAYRMLYNRQEAEDVVQ
51 DVFLRVYKNLERYDASMKFSTWIYRIATNLCIDRLRKRKPVYSLDAESSE
101 HEGLDGYAMIPSDDRTPETELLLSDTQRIIHQAIATLPAKYKSVMVLRYL
151 EDMSLQEIGDVLEMPVTTVKTRVHRGREFLRKKLEHKL

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more