ECF proteins of ECF group ECF237

Displaying ECF 1 - 20 of 131 in total
Name Aliases LCA Taxa Group Subgroup
ECFp161186
  • hypothetical protein
  • BJP36_00250
Moorea producens JHB ECF237 ECF237s1

>ECFp161186 ECF237 ECF237s1 Moorea producens JHB

1 MRSTQIEFGVSARLTLGTNLSSHGQSRDKTEKETSSWVETLLEKLSDGDS
51 SAFWPLWEHYQDYLYHRCLSWMGGNRSQAQDALSEIMLKAWEKLPKFAAK
101 ITNLKGWLTKLARNFCIDRHRENNSGAIGVENLEGMAVPEGNGLVTEFDT
151 PDLVVEKRELLEVIQSALEDLPENQRQVCVLRFEQELSHQEIAQRLAISN
201 DSVRKRIQRARKILQERLTKYLAGLDEKAYGEIAKLQKIRGVEEQESKEQ
251 KDEESDVTPSDKEIGKGEQETTENSESLRPMPVSESASVEEPSKDLDKTR
301 VEITSLDKPDLAVEPAVEITSLDKPALAVEPGSEVPKVILINKAPRSRNS
351 KSQQILSRPRSSQALLPLAGKSLLGSTPNPQSNQGSVRNTIQSHGVKLVT
401 PQKIAISPPLLEHGSIEAPIAKDLSQFSILVLARIVSWWGIFKIKVEPRC
451 HQRLDQWDRGPPF

>ECFp161762 ECF237 ECF237s1 Planktothrix serta PCC 8927

1 MMKNSLTGKNLNHTQMLISSCHLAPNSRHLSKDIDLDFGEEEPILLKRLS
51 LGDDNAFWQLWQQHQKYLYYRCLSWMGGNPIEAEEALSLAMLKARDKLPN
101 SADKITNFRAWLIRLTHNLCVDIHRARCRKAIRIETVEEDEAVISNFDCP
151 ESAILRDELGQVIRSAVDTLPERLRIPFILRYYEQVSYPDIAQQLAISQD
201 IALRAMVRTKV

>ECFp96059 ECF237 ECF237s1 Moorea producens

1 MLATNLSSHPPSGENAENDTAFWVESLLEKLSDGDSSVFWPLWENYKDYL
51 YHRCLSWMGGNTTEAQDALSEIMVKAWEKLPKFAAKITNLKAWLTKFARN
101 FCIDRHRENNSGAIGVENLEGMAVPEGNGLVTEFDTPDLVVEKNELLEVI
151 QSALEDLPENQRQVCVLRFEQELSHQEIAQRLAISNDSVRKRIQRARGIL
201 QQQLTKYRAGLDEKAYGEIAKLQEIRGVEEQESRDEKDEESDLTPSNKEI
251 GKGEQQTTEKLESFCPITASDSATVEGCSKDLDKTGVEITSLDKPDLAVK
301 PGVEITSLDKPALAVEPESEVTQVIPIKKEPRTRDTKSQLILSRPRSSQA
351 LLPLAGQLLLESTPNPQSNHGSDRNTIQSHGVKLLTPQEIGISPPPLEHG
401 SIQAPIAKDISQFPIPILATIASWWGIFKTKVESSWNQRSDKGDRGPPDQ
451 L

>ECFp81567 ECF237 ECF237s1 Moorea producens

1 MLATNLSSHPPSGENAENDTAFWVESLLEKLSDGDSSAFWPLWEHYKDYL
51 YHRCLSWMGGNTTEAQDTLSEMMVKAWEKLPKFAAKITNLKGWLTKFAHN
101 FCIDRHRENNSGAVGIENLEGMAVPEGNGLVTEFDSPDLVVEKNELLEVI
151 QSALEDLPENQRQVCVLRFEQELSHQEIAQRLAISNDSVRKRIQRARGIL
201 QKRLTKYRAGLDQKAYGEIAKLQEIRGVEEQESKEEKDRESDVTPSNQEI
251 GKGEQEKTENSESLRQMPVSESVSVEEPYKDLDKTGVEITSLDKPDLAVK
301 PAVEITSLDKPALAVEPLSELPKVIPIKKEPRSRDSKNQQILSRPRSSQA
351 LLPLAGKSLLGSTPNPQSNHGSDRNPIQSHGVKLLTPQEIGISPPPREHR
401 SIQAPIAKDISQFPILILATIVSWWGTLKTKVEPSWNQRSHTGNRGPPDQ
451 LSFLVMANLLIAAQGHYLE

>ECFp102981 ECF237 ECF237s1 Moorea producens PAL-8-15-08-1

1 MGASQMNFGVSTGALMQPTNQGFHGQWRENAEKQSTPAWVEPLLEKLSTG
51 DRTAFWPLWEQYQDYLYHRCCSWMGGNRSQAQDALSEIMLKAWEKLPKFA
101 AKITNLKGWLTKFAHNFCIDCHRENNSGAIGVENLEAIAVAEGNGLVTEF
151 DTPGQILEKRELLQVIRSALEDLPENQREVCLLHFEQELSYQEIAQRLDI
201 SNNTVRKRIQRARQKLQQPLHTYLAGLDQNAYGDIALLDAVAHGGNPQDR
251 TGSRSWGEPPRPHR

>ECFp103216 ECF237 ECF237s1 Moorea producens PAL-8-15-08-1

1 MKTETKLDEINLLKSISLGDRTAFWKLWLVNQDYLYGRCVTWMGGDRTNA
51 EEALSLARMKAWDKLPHHAEKITNPKAWLTRMTHNLCVDLHRKRHRGAIG
101 MDSIEEMAVGEHQTLASSDYSPESAILRRELRMYIRREIDALSPQLREPF
151 VLHFYQDIPYPDIAKKLALSVDNVYKRIQKGRAIMEKQLKRYLSGIDDSP
201 PLLKEIEKDDIWDEVKTKKSVIPSQNATTKKCHFEQINDKINYEVTAICL
251 ETLTPVW

Name Aliases LCA Taxa Group Subgroup
ECFp104040
  • RNA polymerase sigma factor, sigma-70 family
  • KR51_00013590
Rubidibacter lacunae KORDI 51-2 ECF237 ECF237s1

>ECFp104040 ECF237 ECF237s1 Rubidibacter lacunae KORDI 51-2

1 MILRTKLDSLLTYMRNARIDQPIRSRARQPAARVTSHPPDSAKGKAEHTQ
51 YLRCLAAGDRAAFWPLWRQHNDYLYRRCLIWMGGNPNDAEEALSRATLKA
101 WEKLPVYADRIENLRAWLTRMTHNLCVDMHRERGRAAMPVGDIEELIASG
151 SIRSRMESPETVLLRQELNCHLRTAISELPAGLREPFVLHHCQEQPYTQI
201 ASYLGLTNANARKRVQQARSQLKRRLSRYLNGREPAIARRRQNVPTRTAL
251 AATAAI

>ECFp165504 ECF237 ECF237s1 Roseofilum reptotaenium AO1-A

1 MQRKRLISNTFSGSRSGNKVLDSVEEEKLLQNLSEGDMNAFWPLWQSHQE
51 YLYFHCLRWLNNDRHEAEDALSLAMLKARKTLPDYAHKITNLQAWLTRLT
101 HNLCIDKYRQARRRAIGVENIDEIATISLDSLLISYTSPESTLLSEELSR
151 SIVQAINMLPERLRQLFILRYYHQVSCADIAQDLGISQDNAYKRIQEAKE
201 CLRKRLKHYLSGQKYSVLHSSRDGVNHQTSVDKCSLSDAPSANNIRSINP
251 PISYHLTATCLVKVSHLSL

Name Aliases LCA Taxa Group Subgroup
ECFp104690
  • RNA polymerase ECF-type sigma factor
  • RNA polymerase subunit sigma-24
  • ... more
Arthrospira platensis ECF237 ECF237s1

>ECFp104690 ECF237 ECF237s1 Arthrospira platensis

1 MEIKDPIRRYRSPKANDVQPLKQPEEQELLNRLSEGEMNAFWPLWYYHQN
51 YLFHRCISWMENNRTEAEEALSIAMLKARDKLPKYAPKITNLRAWLTRLT
101 HNLCLDIHRERRRKSISIDNIEDSYIQAKEVILCSCESPESQILRHELRQ
151 FIQSVVNQLPERLRIPFILRYDRELSYPDIAEKLGISRDNAYKRIQQARD
201 IIAQKVRSYLSGVDPFESTLSESFYVTNNLLIEDSKIDDLSGVECKSVVV
251 SYHLTATCLDQLSHTWHFLPGFVAYKNRHQST

>ECFp105852 ECF237 ECF237s1 Arthrospira sp. PCC 8005

1 MEIKDPIRRYRSPKANDVQPLKQAEEQELLNRLSEGEMNAFWPLWYYHQN
51 YLYNRCISWMENNRTEAEEALSLAMLKARDKLPKYAPKITNLRAWLTRLT
101 HNLCLDIHRERRRKSISIDNIEDSYIQAQDVILCSCESPESQILRHELRQ
151 FIQSVVNQLPERLRIPFILRYDRELSYPDIAEKLGISRDNAYKRIQQARD
201 ILAQKVRSYLSGVDPFESTLSESFYVTNNLLIEDSKIDDLSGVECKSVVV
251 SYHLTATCLDQMSHTWHFLPGFAAYKNRHQST

Name Aliases LCA Taxa Group Subgroup
ECFp107257
  • hypothetical protein
  • OSC10802_RS0134230
Oscillatoria sp. PCC 10802 ECF237 ECF237s1

>ECFp107257 ECF237 ECF237s1 Oscillatoria sp. PCC 10802

1 MQRKKPKSKTRSLSVNQIRNLTKLEEKQLLQRLSEGEMSAFWQLWQQHQK
51 YLYHRCISWMGGNHTHAEEALSLAMLKALQQLPACAERITNLRAWLTRFT
101 HNLCVDIHRERRRKAIGMESLEEIAVKEEEAVISSLDCPESAILRDELGQ
151 VIRDAVDALPSRLRTPFVLLYYHQVSYPDIAQQLALSQDNAYKRIQQARD
201 ILKKRLIRYLSGADNSVLASSETSCKKSNFVVVSSQSDSPVAMDSGCMIA
251 AINYQLTATCLEKLSHASYCSPSHQGWR

Name Aliases LCA Taxa Group Subgroup
ECFp111876
  • hypothetical protein
  • SE18_03425
  • ... more
Herpetosiphon geysericola ECF237 ECF237s1

>ECFp111876 ECF237 ECF237s1 Herpetosiphon geysericola

1 MNSDVCNQNQPSETVAIQLVEQICRGEQAAIWELYSLYQAELSRQCLIWM
51 HGNAHDADEALSRLVLKVWESLPRHAHKITNAKAWLMRMAYNLCIDLHRQ
101 QQRELKRLQPLDSLLSNDESMPQSATPSPETALLKREVYETINQALQALS
151 PRLNSTFSLWFYNDMSCDAIAQHQGISLANVYKRLQQARDMLQPQLRPTT
201 VEG

Name Aliases LCA Taxa Group Subgroup
ECFp112893
  • hypothetical protein
  • TOL9009_RS42210
[Scytonema hofmanni] UTEX 2349 ECF237 ECF237s1

>ECFp112893 ECF237 ECF237s1 [Scytonema hofmanni] UTEX 2349

1 MQASPSDQKFLLKSLSQRDYTAFWQIWMPYQDYLYHCCLTWMDGNVTDAQ
51 DALSQATLKAWDKLPHHADKITNLKAWLTRFTHNVCMDIHREHGRRTIGI
101 DNFEEIAGQVEVVTFPVESSESAILDSEIEITIRCAIKALPSRLRSPFIM
151 RFEQDMSYLDIAQKLGISIDNVYKRISQARSILKQQMNKYLLQEDDSAFL
201 EIPLPSIKKKKPTKANLNKKIQQKLAAAWLTQAEASGEALHNREMQCLYC
251 LSTHICKNGNRKGKQNYLCKKCDRQFINSYSSKRYPSEVRERCLKLYADG
301 MGYRAIARETGVSHNTVINWVKQDVP

>ECFp114710 ECF237 ECF237s1 Microcystis aeruginosa TAIHU98

1 MLSSLNKTQKNSRQKHQSVTAEANLLKQLSLGEQKAFWSLWLSHQEYLYC
51 RCINWMGGNRKDAEEALSRATIKAWEKLPIHAEKITNSQAWLTRMTHNVC
101 VDIHRENQRQARGIEDIDTILESENYLLMLSQSNPYYLMLQAEIQEHIRQ
151 AIDQLPSKLRETFVLRFEQEMSYSEIAKKLSISNSNVRKRIQQAREALQR
201 QLGQYL

>ECFp114933 ECF237 ECF237s1 Arthrospira sp. TJSD091

1 MEIKDPIRRYRSPKANDVQPLKQAEEQELLNRLSEGEMNALWLLWYYHQN
51 YLYNRCISWMENNRTEAEEALSLAMLKARDKLPKYAPKITNLRAWLTRLT
101 HNLCLDIHRERRRKSISIDNIEDSYIQAQDVILCSCESPESQILRHELRQ
151 FIQSVVNQLPERLRIPFILRYDRELSYPDIAEKLGISRDNAYKRIQQARD
201 ILAQKVRSYLSGVDPFESTLSESFYITNNLLIEDSKIDDLSGVECKSVVV
251 SYHLTATCLDQMSHTWHFLPGFAAYKNRHQST

Name Aliases LCA Taxa Group Subgroup
ECFp165174
  • hypothetical protein
  • KR51_RS06065
Rubidibacter lacunae KORDI 51-2 ECF237 ECF237s1

>ECFp165174 ECF237 ECF237s1 Rubidibacter lacunae KORDI 51-2

1 MTSHPPDSAKGKAEHTQYLRCLAAGDRAAFWPLWRQHNDYLYRRCLIWMG
51 GNPNDAEEALSRATLKAWEKLPVYADRIENLRAWLTRMTHNLCVDMHRER
101 GRAAMPVGDIEELIASGSIRSRMESPETVLLRQELNCHLRTAISELPAGL
151 REPFVLHHCQEQPYTQIASYLGLTNANARKRVQQARSQLKRRLSRYLNGR
201 EPAIARRRQNVPTRTALAATAAI

>ECFp166603 ECF237 ECF237s1 Moorea bouillonii PNG

1 MKTETKLDEINLLKSISLGDRTAFWQLWLVNQDYLYGRCVTWMGGDRTNA
51 EEALSLARIKAWEKLPHYAEKITNPKAWLTKMTHNLCVDLHRKRHRSAMG
101 MESIEEMAVGEHQTLASSEYSPESAILRRELKMYICREIKALSPQLREPF
151 VLYFYQDISYPDIAKKLAISVDSVYKRIQKGRAIMEKQLKQYLSGIDNSP
201 PFLKELGEDDIFNNFKNKKLVILSQKPTTESKIDQINNHINYEVTAICLE
251 TLPPVW

>ECFp77328 ECF237 ECF237s1 Microcystis aeruginosa PCC 9443

1 MLFSLNKTRKTSRQKHQSVTAEANLLKQLSLGEQKAFWSLWLSHQEYLYY
51 RCINWMGGNRKDAEEALSQATIKAWEKLPIYADKITNPKAWLTRMTHNVC
101 VDIHREHQRQARGIEDIDTILEIENSPLMLSQSNPNSLMLQAEIQEHIRQ
151 AIDQLPPRLRETFVLRFEQEMSYAEIAEKLSISNSNVRKRIQQAREALQR
201 QLGQYL

>ECFp81432 ECF237 ECF237s1 Arthrospira

1 MEIKDPIRRYRSPKANDVQPLKQAEEQELLNRLSEGEMNALWLLWYYHQN
51 YLYNRCISWMENNRTEAEEALSLAMLKARDKLPKYAPKITNLRAWLTRLT
101 HNLCLDIHRERRRKSISIDNIEDSYIQAQDVILCSCESPESQILRHELRQ
151 FIQSVVNQLPERLRIPFILRYDRELSYPDIAEKLGISRDNAYKRIQQARD
201 ILAQKVRSYLSGVDPFESTLSESFYVTNNLLIEDSKIDDLSGVECKSVVV
251 SYHLTATCLDRQLSIGLVNTEG

>ECFp94716 ECF237 ECF237s1 Candidatus Entotheonella gemina

1 MMVHTPQQTRAPMPACRVPADTPPIGQSTTEQQLLDRVAAGDMAALWPLW
51 ERYHDYLYDRCLQWMGGDPTEAEDMLSNAMLKVYEHLPRRAHNITNLKAW
101 LIRVTHNLCVDVQRSRARHPTGTEYLDEMHVPAGETLGSTLASPEQIILW
151 HEIHKCLWRSLDDLPPHLRESLELRILQEKPYPNIAAQLGISNANVRKRV
201 QLARELLRKRLHRHLYGRKIA

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more