ECF proteins of ECF group ECF218

Displaying ECF 1 - 20 of 3037 in total
Name Aliases LCA Taxa Group Subgroup
ECFp135701
  • ECF subfamily RNA polymerase sigma-24 subunit
  • RNA polymerase subunit sigma-24
  • ... more
Actinoplanes friuliensis DSM 7358 ECF218 ECF218s23

>ECFp135701 ECF218 ECF218s23 Actinoplanes friuliensis DSM 7358

1 MKSATEHEDRFRRMYAANFAPLLAYAVRRVEQHEDAADVVAETFLIAWRR
51 GHELPPGDEARLWLYGVARRVLSNHHRGGVRRERLGDRLRQRLAAVVTAD
101 PAGEVVERLTVQAALARLGDLDREVLTLTIWEGLQPREVAAVLQVTPEAV
151 RTRLSRARAKLRELVGDDLHPPGHELDVLTAPNPKEGR

>ECFp177712 ECF218 ECF218s23 Nonomuraea jiangxiensis

1 MGVDPGSRFEEIYGSSYGQLLGYALRRCLDPDDAADVVAETFLIAWRRLE
51 EVPEGDEARLWLFGVARKVLANQRRGERRHERRTAALRAELAATPLVADL
101 PGEDLSQLGQVFRALPEDDRELLALVAWERLDPGQIARVLGITRNAARVR
151 IYRARKRFARALAAAGIDHSRAVALEGSGL

>ECFp177728 ECF218 ECF218s23 Solirubrobacterales bacterium 70-9

1 MEALGQELAQVRFTKLYREHGRAVLEYALRRVEAREDAADVVAETFLVVW
51 RRIGEVPEGDGARLWLYGVARHVLANLHRAERRRTRLGARLAETLRTTIA
101 AHPQPRGEAAAVLRAIADLADDDRELLLLVTWEELSPSEAARVLGISALA
151 ARSRLHRARGRLRRLLEERDTEGER

>ECFp177694 ECF218 ECF218s23 Actinoplanes derwentensis

1 MSSGDEHEQRFRRVYAENFQALLAYALRRVEQPADAADVVSETFLVAWRR
51 SRDLPPEEEIRLWLYGVARRVLANHHRGGTRRERLGDRLRQRLTAVLSRD
101 PGSDVPQRLVVRAALARLDETDRELMMLTIWEGLQPREAAEVLALNPGAV
151 RTRLSRARARLRELVGDDLGPPGHELDVLTGTAAPKEGR

Name Aliases LCA Taxa Group Subgroup
ECFp135315
  • hypothetical protein
  • A3CQ_RS0112050
Actinoplanes globisporus DSM 43857 ECF218 ECF218s23

>ECFp135315 ECF218 ECF218s23 Actinoplanes globisporus DSM 43857

1 MNVRSGTDHDEHFRRVYAATFEPLLAYALRRVEQPADAADVVAETFLVAW
51 RRRREIPAEGEARLWLYGVARRVLANHHRGGVRRERLGQRLRQRLSESSP
101 DPATEVPERLAVRAALARLGELDREVLMLTVWEGLEPREAAAVLDVSAAA
151 VRTRLSRARARLRQLVGDDPALPGHVLDVLTAPVPEEGR

>ECFp135220 ECF218 ECF218s23 Nonomuraea sp. NBRC 110462

1 MTHRDRFEAVYDAYYPAIHQYAARRTGSPDDTADVISETFLTAWRRIGDV
51 PEGEEALLWLYGVARRVLANRQRGESRRAVLTERLRAELAADRPVRPVDL
101 DHVRAAFDGLPERDREVLALACWEGLTSQRIAKVLGCTAIAARTRLHRAR
151 KRMAAALERQASLTIAMGEA

Name Aliases LCA Taxa Group Subgroup
ECFp135243
Jiangella muralis ECF218 ECF218s23

>ECFp135243 ECF218 ECF218s23 Jiangella muralis

1 MPAWSTHRHDDETTRRGRFEAVFAAESRAILGYALRRVEAAEDAADVVAE
51 TFLVAWRRIDDVPAGAQARPWLYGVARRVLANHARGARRRTRLGERLRDE
101 LLTGPDVIRIDEDDPAATVRAALLRLPGDDRELLRLTSWEGLGPAELATA
151 MGLPPGTVRTRLHRARKRLRAELEALGRDGERPAPTGHVNGDGRLSVRLE
201 EGS

>ECFp135277 ECF218 ECF218s23 Herbidospora daliensis

1 MDERQARFEQVYHETYGHLSAYAARRCADPHDAADVVAETYEIAWRKIAR
51 LPSGHEALLWLYGIARRVVAGHRRGEARRRSRLAELDADLAALYADPVEL
101 TAIHEIFATLRADDRELLGLIAWEGLSHEEIAAVLGISRNAVRIRLHRAR
151 RRFSDLLDKAALRAERSP

>ECFp135272 ECF218 ECF218s23 Nonomuraea sp. SBT364

1 MSGTFRQGDFVTHRDRFEAVYDAHYPAIHQYAARRTGSPDDTADVLSETF
51 LTAWRRIGDVPEGEEALLWLYGVARRVLANQRRGAARRAVLTERLRAELA
101 ADRPVSPAGLEHVRAAFDGLPQRDREVLALACWEGLTGEQIAKVVGCTAI
151 AARTRLHRARKRLTAALERQASLTIAMEEA

>ECFp135298 ECF218 ECF218s23 Micromonospora parva

1 MSPGTEQDEDRFRRAYAEDFESLLAYALRRVAHPEDAADVVAETFLVAWR
51 RRQDIPVAGAARLWLYGVARRVLANHHRGGVRRQRLGERLRQQIAASVTD
101 PGSEVPERLAVRAALSGLAEMDREVLMLTVWEGLQPHEVAAVLGVSAAAV
151 RTRLSRARVRLRALVGDDPGPPGHVLDVLTASTRKED

>ECFp135423 ECF218 ECF218s23 Herbidospora daliensis

1 MSDHLRQGDAVTHRDRFEAVYDAYYPAIHQYAARRTGSPDDTADVISETF
51 LTVWRRIGDLPEGEEALLWLYGVARRVLANQQRGATRRAVLAERLRAELA
101 ADRPVTPVELEHVRAAFDELRERDREVLALACWEGLTSDRIAKVVGCTAF
151 TARTRLHRARKRLAAALERQASLTIAMGET

>ECFp135393 ECF218 ECF218s23 Micromonospora sp. NRRL B-16802

1 MSSTTEHEDRFRRVYAANFAPLLAYAVRRVEQPEDAADVVAETFLVAWRR
51 SHQMPPDTEVRPWLYGVARRVLANHHRSGLRRGRLGDRLRQRLRAVIVAD
101 PGNEVPERLTVRAALARLSDQDRELLMLTFWEGLEPREAAEVLGISPAAV
151 RTRLSRARGRLRHLVGDDSGPPGHVFDVLAVRAPKEG

>ECFp135415 ECF218 ECF218s23 Micromonospora sp. HK10

1 MSSGTDHEDRFRRVYAADFQPLLAYALRRVAHPEDAADVVAETLLVAWRR
51 REDLPPDGEARLWLYGVARRVLANHHRGGVRRQRLGERLRHRITATMAAD
101 PGSEVPERLAVRAALARLGELDREVLMLTVWEGLEPREAASVLRVSPAVV
151 RTRLSRARARLRELVGDDLGPPGHVPGVLAAPAPKEGR

Name Aliases LCA Taxa Group Subgroup
ECFp135457
  • RNA polymerase subunit sigma-24
  • RNA polymerase, sigma-24 subunit, ECF subfamily
  • ... more
Micromonospora lupini str. Lupac 08 ECF218 ECF218s23

>ECFp135457 ECF218 ECF218s23 Micromonospora lupini str. Lupac 08

1 MSSGTEHGEDRFRRVYAEAFESLLAYALRRVAHPEDAADVVAETFLVAWR
51 RRQDIPDGGEARLWLYGVARRVLANQHRGGVRRQRLGERLRQQLVVSVAD
101 PGSEVPERLAVRAALAGLAEVDREVLMLTVWEGLRPHEVAAVLGVAPAAV
151 RTRLSRARARLRGLVGDDPGPPGHVLDVLTAPTRTED

>ECFp135520 ECF218 ECF218s23 Herbidospora cretacea

1 MDERQARFEQVYHETYGHLSAYAARRCANPHDAADVVAETYEIAWRKIAR
51 LPFGHEALLWLYGIARRVVAGHRRGEARRRSRLAELDADLAALYADPVEL
101 TALHEIFATLRADDRELLGLVAWEGLSHEEIAAVLGISRNAVRIRLHRAR
151 RRFSDLLDKAALQAERSP

>ECFp135487 ECF218 ECF218s23 Microtetraspora niveoalba

1 MTHRDRFEAIYDAYYPAIHQYAARRTGSPDDTADVISETFLTAWRRIGDV
51 PEGERALLWLYGVARRVLANQRRGAARRAVLAERLRDELAADRPAASVDL
101 EHVRAAFDELPERDREVLALACWEGLTGEQIAKVVGCTAIAARTRLHRAR
151 RRLAASLRRQPRPAILMGDA

Name Aliases LCA Taxa Group Subgroup
ECFp135562
  • hypothetical protein
  • ASG90_09885
  • ... more
Nocardioides sp. Soil797 ECF218 ECF218s23

>ECFp135562 ECF218 ECF218s23 Nocardioides sp. Soil797

1 MSLIAEERFRALHTAHFRDLLGFALRRTATADDAADVVADTFVVAWRRLD
51 EVPPGNEGRLWLYGVCRRTLANHTRSGRRRERLGAKLGSALREAVVPDPA
101 DEVLLTVSVRAALAALRPADRELLALSIWEQLEPGEIAVVLDLPARTVRT
151 RLSRARARLRHKLGGDGPPGDGHVLRDGGAVLPTRLAPGEAR

Name Aliases LCA Taxa Group Subgroup
ECFp135542
  • RNA polymerase subunit sigma-24
  • CRYAR_RS25000
Cryptosporangium arvum DSM 44712 ECF218 ECF218s23

>ECFp135542 ECF218 ECF218s23 Cryptosporangium arvum DSM 44712

1 MTSDERFRRIYAAHFDALLAYAIRRVEQPEDAADVVAEAFVVVWRRRGDV
51 PPDDEVRMWLYGVARRVLANHHRGRARRDRLGERLRQRLRAVVPTDPGSD
101 VPHRLVLRAALARLSALDREVLMLTFWEGLEPREIATVLGLSAPTVRARL
151 SRARRRLRELVGHDLGPPGHELGVRTGRTPEEGR

Name Aliases LCA Taxa Group Subgroup
ECFp135586
  • RNA polymerase subunit sigma-24
  • ASE12_09190
  • ... more
Aeromicrobium sp. Root236 ECF218 ECF218s23

>ECFp135586 ECF218 ECF218s23 Aeromicrobium sp. Root236

1 MTSRDHDERFRTFYAEHFDALLAYAVRRVPQREDAADVVADTFLVAWRRV
51 DELPPGDEARLWLYGVARKVLFNLRRSRQRRDRLGLRLRHELAHAAAEDA
101 TADVTERIALRAALSRLGEIDREVLTLTVWEELEPREIAQVLGLSAQTVR
151 TRLSRARARLREQLGNDMGVVGHVLGVRTEPRPEEGR

>ECFp135687 ECF218 ECF218s23 Streptosporangium roseum

1 MTHRDRFEAVYDAYYPAIHQYAARRTGSPDDTADVISETFLTAWRRIDDV
51 PEGEEALLWLYGVARRVLANQQRGASRRAGLAERLRAELAADRPVRPVEL
101 EHVRAAFDELPERDREVLALACWEGLTSERIAKVVGCTAIAARTRLRRAR
151 KRLAASLERQASLTIAMGEA

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more