ECF proteins of ECF group ECF19

Displaying ECF 1 - 20 of 3388 in total
Name Aliases LCA Taxa Group Subgroup
ECFp112124
Kocuria turfanensis ECF19 ECF19s22

>ECFp112124 ECF19 ECF19s22 Kocuria turfanensis

1 MPPPPPEWGPELDAAFAAGDEQALSAAYRHCAGVIRGLAVRVLRDDTAAD
51 DVVQEVFVRAWKYRSGYRPEHSSVPAWLIGIARNCIADAARTAGREAERR
101 EADAVRSDREPRHEESDLLVDRLVVRAEVERLGPPRSTIMALAFYEELTH
151 QQIAQHLDLPLGTVKSHLRRGLMNLRTRLGDGHGTPE

Name Aliases LCA Taxa Group Subgroup
ECFp168909
Kocuria sp. CNJ-770 ECF19 ECF19s22

>ECFp168909 ECF19 ECF19s22 Kocuria sp. CNJ-770

1 MPPPPPDWGPELDAAFAAGDEQALSAAYRHCAGVIRGLAVRALRDDTAAE
51 DVVQEVFIRAWKYRSGYRPEQSSTPAWLIGIARNCIADAARTAGREAERR
101 QADAVRSDREPRHEESDLLVDRLVVRAEVERLGPPRSTIMALAFYEELTH
151 QQIAQHLDLPLGTVKSHLRRGLINLRTRLGDGHGTPE

Name Aliases LCA Taxa Group Subgroup
ECFp86031
  • hypothetical protein
  • GY22_11860
  • ... more
Kocuria polaris ECF19 ECF19s22

>ECFp86031 ECF19 ECF19s22 Kocuria polaris

1 MPPPPPDWGPELDAAFAAGDEQALSAAYRHCAGVIRGLALRALRDDAGAD
51 DVVQEVFIRAWKYRSGYRPEHSSAPAWLIGIARNCIADAARTAGREAERR
101 QADAVRTDREPRHEESDLLVDRLVVRAEVERLGPPKSTIMALAFYEELTH
151 QQIAQHLDLPLGTVKSHLRRGLTNLRTRLGDGHGTPE

Name Aliases LCA Taxa Group Subgroup
ECFp77909
Demequina flava ECF19 ECF19s22

>ECFp77909 ECF19 ECF19s22 Demequina flava

1 MSAGSPPVHDAALAHAFAAGDHGALEDLYKNVSSLIYTMAVRSLGSSADA
51 DDVTQQTFVSAWKARESFDPDKGDLRGWTVGIAKRRIADALAARAREVRR
101 AEAAQENVTSIRGDDADSVLLAYEVEALGDPRKTIIALAYYEGATHEQIA
151 ARLDMPLGTVKSHVRRSLQELRHRWEVSDVAS

>ECFp98530 ECF19 ECF19s22 Lysinimicrobium rhizosphaerae

1 MVTEATERDDAPDDRSVDRDFAAGVDGSLERLYRESSALVFTLALRALGD
51 RTDAEDVTQQTYVAAWRGRERFDPDRGPARAWVVGIAKRTIADALAARSR
101 ERRRLEAVRDLPTPGEADPLAAEAERIVVRGEVESLGPPRSTIVALAFFE
151 GRTHEQIATELRMPLGTVKSHLRRSLLALRRGLEAADASL

>ECFp108280 ECF19 ECF19s22 Lysinimicrobium aestuarii

1 MAAETAERDDAPDRRSLDRDFAAGVDGSLERLYRESSALVYTLALRALGD
51 RAEAEDVTQQTYVAAWRGRDRFDPDRGSARGWVVGIARRTIADALEARSR
101 ERRRLEAVRELPVPGEPDPLAAEAERILVRGEVEGLGPPRSTIVALAFFE
151 GRTHEQIATELRMPLGTVKSHLRRSLIALRRGLEAADASL

Name Aliases LCA Taxa Group Subgroup
ECFp107128
Kocuria sp. SM24M-10 ECF19 ECF19s22

>ECFp107128 ECF19 ECF19s22 Kocuria sp. SM24M-10

1 MPPPPPDWGPELDAAFAAGDEQALSAAYRHCAGVIRGLAVRALRDDTAAD
51 DVVQEVFIRAWKYRSGYRPEQSSTPAWLIGIARNCIADAARTAGREAERR
101 QADAVRSDREPRHEESDLLVDRLVVRAEVERLGPPRSTIMALAFYEELTH
151 QQIAQHLDLPLGTVKSHLRRGLINLRTRLGDGHGTPE

Name Aliases LCA Taxa Group Subgroup
ECFp108934
  • hypothetical protein
  • AS188_00695
  • ... more
Kocuria flava ECF19 ECF19s22

>ECFp108934 ECF19 ECF19s22 Kocuria flava

1 MPTPPPEWGPELDAAFAAGDEHALAAAFRHCAGLVRALAVRALRDDAAAD
51 DVVQEVFVRAWKYRSGYSPERSSAPAWLVGIARNCIADAARTAGREAAQR
101 QAAVAGEHGGTHEEADLLVDRMLVRSEIRRLGPPRSTIVALAVYGELTHQ
151 QIAHRLDLPLGTVKSHLRRGLTHLRTRLEDDHGTPE

>ECFp110401 ECF19 ECF19s22 Lysinimicrobium aestuarii

1 MAAETAERDDVPDRRSLDRDFAAGVDGSLERLYRESSALVYTLALRALGD
51 RAEAEDVTQQTYVAAWRGRDRFDPDRGSARGWVVGIARRTIADALEARSR
101 ERRRLEAVRELPVPGEPDPLAAEAERILVRGEVEGLGPPRSTIVALAFFE
151 GRTHEQIATELRMPLGTVKSHLRRSLIALRRGLEAADASL

>ECFp110604 ECF19 ECF19s22 Lysinimicrobium subtropicum

1 MVAEAAEPDGAVGDRALDHEFAAGAEGSLERLYRESSSLVFTLALRALGD
51 RAEAEDVTQQIYVAAWRSREGFDPDRGSARGWVVGIARRVIADALASRTR
101 DRRRLDAARQAVEEPTADPLAHEADRIVVRGEVENLGPPRSTIVKLAFFE
151 GRTHEQIATELRMPLGTVKSHLRRSLVALRRGLEAADASL

>ECFp111597 ECF19 ECF19s22 Lysinimicrobium rhizosphaerae

1 MVTEATERDDAPDDRSVDRDFAAGVDGSLERLYRESSALVFTLALRALGD
51 RTEAEDVTQQTYVAAWRGRDRFDPDRGPARAWVVGIAKRTIADALAARSR
101 ERRRLEAVRDLPNPGETDPLAAEAERIVVRGEVESLGPPRSTIVALAFFE
151 GRTHEQIATELRMPLGTVKSHLRRSLLALRRGLEAADASL

>ECFp112242 ECF19 ECF19s22 Lysinimicrobium luteum

1 MVAVATERGDASDGLDHAFAAGVDGSLERLYRETSSLVFTLALRALGDRA
51 EAEDVTQQTYVAAWRGRAGYDPERAPARAWVVGIARRTIADALAARGRER
101 RRLEAVRDVPAAVEPDPWAGEAERIVVRSEVESLGPPRSTIVALAFFEGR
151 THEQIAAELKMPLGTVKSHLRRSLLALRHGLEAADAAL

Name Aliases LCA Taxa Group Subgroup
ECFp116037
Kocuria polaris ECF19 ECF19s22

>ECFp116037 ECF19 ECF19s22 Kocuria polaris

1 MPTPPPDWGPELDTAFAAGDEQALSAVYGHCAGVIRGLAVRALRDDAGAD
51 DVVQEVFIRAWKYRSGYRPEHSSAPAWLIGIARNCIADAARTAGRDAERR
101 QADAVRTDREQQHEESDLLVDRLVVRAEVERLGPPRSTIMALAFYEELTH
151 QQIAQHLDLPLGTVKSHLRRGLTNLRTRLGDGHGTPE

Name Aliases LCA Taxa Group Subgroup
ECFp115324
Demequina aurantiaca ECF19 ECF19s22

>ECFp115324 ECF19 ECF19s22 Demequina aurantiaca

1 MAFAAGAEGSLERVYRDASALVYTLAVRALGDPHEAEDVTQQTFVSAWRA
51 RDTFDPSRGEVRGWVVGIARRRIADALDKRRRENRKVDAVRSVVEDSSSL
101 DAELDQVLLSYELETLGDPRRTIMALAFVDGQTHEQISEQLEMPLGTVKS
151 HIRRSLITLRNRWEVSDVAS

Name Aliases LCA Taxa Group Subgroup
ECFp152283
  • hypothetical protein
  • TR42_RS04185
Lysinimicrobium mangrovi ECF19 ECF19s22

>ECFp152283 ECF19 ECF19s22 Lysinimicrobium mangrovi

1 MRIAVGTAMAAETAVRADRPEDRELDRDFAAGAEGSLERLYASAAPLVHT
51 LALRSLGDAAEAEDVTQQTFVAAWRGRDGYRPERGSARGWVVGIARRRIA
101 DALDARARERRRLEAVADQPVARDPDPLATEAERIMVRGEVESLGPPRST
151 IVALAFFEGHTHEQIADRLSMPLGTVKSHLRRSLLALRHGLEAADASL

Name Aliases LCA Taxa Group Subgroup
ECFp165854
Kocuria sp. UCD-OTCP ECF19 ECF19s22

>ECFp165854 ECF19 ECF19s22 Kocuria sp. UCD-OTCP

1 MPPPPPDWGPELDAAFAAGDEQALSAAYRHCAGVIRGLALRALRDAAGAD
51 DVVQEVFIRAWKYRSGYRPEHSSAPAWLIGIARNCIADAARTAGREAERR
101 QADAVRTDREPRHEESDLLVDRLVVRAEVERLGPPKSTIMALAFYEELTH
151 QQIAQHLDLPLGTVKSHLRRGLTNLRTRLGDGHGTPE

>ECFp77060 ECF19 ECF19s22 Demequina globuliformis

1 MSAGPPPVTGAALAHAFAAGDHGALEELYRDVSALVYTMAVRQLGSAADA
51 EDVTQQTFVSAWNGREGFDPDRGDLRGWTVGIAKRRIADALAARARETRR
101 AEAAQERVEPVASDSADAVLLAYEVEALGDPRKTIVALAYYEGATHEQIA
151 VKLDMPLGTVKSHLRRSLQELRHRWEVADVAS

Name Aliases LCA Taxa Group Subgroup
ECFp78551
Demequina oxidasica ECF19 ECF19s22

>ECFp78551 ECF19 ECF19s22 Demequina oxidasica

1 MVSQPPNDGPSDERPDAFSTDDAGIAFAAGAEGSLERIYRDASALVYTLA
51 VRALGDTHEAEDVTQQTFVSAWRARDTFDPSRGEVRGWVVGIARRRIADA
101 LDKRRRENRKVDAVRSVVEDSASLDAELDQVLLSYELETLGDPRRTIMAL
151 AFVDGQTHEQISEQLEMPLGTVKSHIRRSLITLRNRWEVSDVAS

Name Aliases LCA Taxa Group Subgroup
ECFp78559
Demequina aestuarii ECF19 ECF19s22

>ECFp78559 ECF19 ECF19s22 Demequina aestuarii

1 MVVVPSSPRDRDDTARAFALGEDGALEELYRDLSPLVYTMAVRSLGSTAD
51 AEDVTQQTFVSAWRGRAGFDPVRGDLRGWVVGIAKRRIADALESRSREHR
101 RLEAVKESTPADAVTPDDADSVLLAYEVDALGPPRATIVALAFFEGETHE
151 QIARRMDMPLGTVKSHIRRGLIELRDRWEVSDVAS

>ECFp79330 ECF19 ECF19s22 Lysinimicrobium aestuarii

1 MVAETAERDDAPDRRSVDRDFAAGVDGSLERLYRESSALVYTLALRALGD
51 RAEAEDATQQTYVAAWRGRDRFDPARGSARGWVVGIARRTIADALEARSR
101 ERRRLEAVRELPVPGEADPLAAEAERILVRGEVEGLGPPRSTIVALAFFE
151 GRTHEQIATELRMPLGTVKSHLRRSLIALRRGLEAADESL

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more