ECF proteins of ECF group ECF130

Displaying ECF 121 - 130 of 130 in total
Name Aliases LCA Taxa Group Subgroup
ECFp78772
  • RNA polymerase subunit sigma
  • IG78_RS0139555
Streptomyces aureocirculatus ECF130 ECF130s5

>ECFp78772 ECF130 ECF130s5 Streptomyces aureocirculatus

1 MSQSMYSPLDLPIDFEAFYLGHQEAFHGYAEAHFGTRAAAEEVIHKVFLE
51 ILAGWTDLLSTGNLEQGAWAIVRRAVHDRLELEGRLPAFIVNGPITQALA
101 ATRDRIQAMESSSGLYEAIGELQGRQFEVIVLRFILGYPTVKVAWYMGID
151 DRTVDHHIRRAKERLRTKLQIPQDRKRKGEQ

Name Aliases LCA Taxa Group Subgroup
ECFp80998
  • RNA polymerase sigma factor
  • SSP08S_RS45705
Streptomyces hokutonensis ECF130 ECF130s5

>ECFp80998 ECF130 ECF130s5 Streptomyces hokutonensis

1 MSYDDALEGAQAPAPRGGLSQSLYLPLDLPLEFEAFYLGHQEAFHAYAEV
51 HFGTRETAEEVIHEVFLQIHAGWPELLSAGNLEQGAWAIMRRAVHDRLEH
101 EGRAPAFVINGPIAQAMDKALATARDKLQKMESSSGLYEAIAELPNRQFE
151 VIVLRYILGYPTSRVAWYVGIDERTVGHHLRRGKERLRVKLGLPDERKKP
201 KRGQQP

>ECFp83453 ECF130 ECF130s5 Streptomyces griseoruber

1 MSHDDAAEGSPPSIQGAGLSQSMYLPLDLPLDFEAFYLGHQEVFHAYAEV
51 HFGTREAAEDVIHEVFLKIHAGWTELLSAGNLEQGAWAIVRRAVHDRLEL
101 EGRAPAFVINGPITQAMDKALVTARDKLQRMESSSGLYEAIAELPNRQFE
151 VIVLRYILGYPTAKVAWYVGIDERTVGHHLRRGKERLRIKLGLPDERKRP
201 KQKGEGP

>ECFp85136 ECF130 ECF130s5 Streptomyces sp. LUP47B

1 MRYDDAQEGASPAEHGAALSQSMFVPLDLEVDFEAFYLGHHEVFHAYAEV
51 HFGNRETAEEVIHEVFLEIHAGWSQLLSAGNLEQGAWAIVRRIVHNRLDA
101 EGRGPAFVINGPIAQALDTALVTAREKLRKMESSSGLYEAIAELPDRQFE
151 VIVLRYVLGYPTAKVAWYIGIDDRTVGHHLRRAKERLRLKLGLPETPKKH
201 KGVGA

>ECFp87693 ECF130 ECF130s5 Streptomyces sp. NRRL B-1140

1 MSQSMYVPLDLPIDFEAFYLAHQEAFHAYAEVHFGTRAAAEEVIHEVFLE
51 IHAGWTELLGSGHVEQGAWAIVRRAVRDRLESEGRAPAFIINGPIAQALA
101 ATKDRLERMQSTTGLYEAIAELPNRQFEVIVLRYLLGYPTSRVAWFMGID
151 ERTVGHHLRRGKERLRVKLGLPDDRKKPKHKQKGE

>ECFp89115 ECF130 ECF130s5 Streptomyces sp. NRRL WC-3641

1 MSHNDAQEGSSQEYGLGLSQSMYVPLDLPIDFEAFYLGHQEAFHAYAEVH
51 FGTRAAAEEVIHEVFLEIHAGWTELLSAGSLEQGAWAIVRRAVHDRLESE
101 GRAPAFIINGPIAQALATTKDRLQRMQSTTGLYEAIADLPGRQFEVIVLR
151 YLLGYPTSKVAWFMGIDERTVGHHLRRGKERLRVKLGMPEERKKPKQKGE
201 GP

>ECFp94533 ECF130 ECF130s5 Streptomyces

1 MRYDDAPEGASPVEHRTGLSQSMFVPLDLEVDFEAFYLGHHEVFHAYAEV
51 HFGNRETAEEVIHEVFLEIHAGWSQLLSAGNLEQGAWAIVRRIVHNRLDA
101 EGRGPAFVINGPIAQALDTALVTARDKLQKMESASGLYEAIADLPDRQFE
151 VIVLRYVLGYPTAKVAWYIGIDDRTVGHHLRRAKERLRLKLGLPETPKKP
201 KHKGVGA

>ECFp98681 ECF130 ECF130s5 Streptomyces sp. CdTB01

1 MSHDDAQAGASPTEYGSGLSQSMFVPLELPLDFEAFYLGHQEAFHAYAEV
51 HFGTREAAEEVIHEVFLEIHAGWSQLLSAGNLEQGAWAIVRRVVHDRLEA
101 EGRGPAFVINGPIAQALNKALVTARDKLHKMESASGLYEAIAELPDRQFE
151 VIVLRYVLGYDTAKVAWYIGIDDRTVGHHLRRAKERLRVKLGLPDTPKKP
201 KQKGAGA

Name Aliases LCA Taxa Group Subgroup
ECFp99002
  • RNA polymerase sigma factor
  • AAW13_RS42625
Streptomyces humi ECF130 ECF130s5

>ECFp99002 ECF130 ECF130s5 Streptomyces humi

1 MSHDDAPEGTPDAEPRSALSQSMFLPLDLPLDFEAFYLGHQEPFHAYAEV
51 HFGTREVAEEVIHEVFLQIHAGWTELLSSGSLEQGAWAIMRRAVHDRLDR
101 EGRAPAFVINGPIAQALAPALATARDKLQKMESTSGLYEAISELPNRQFE
151 VIVLRYILGYPTAKVAWYVGIDERTVGHHLRRGKERLRVKLGLPDEHKKR
201 HPKGERP

>ECFp105074 ECF130 ECF130s5 Streptomyces yokosukanensis

1 MSHDDALEGAPPPAQGAGLSQSMYLPLDLPLDFEAFYLGHQEVFHAYAEV
51 HFGTRETAEEVIHEVFLQIHAGWMELLSAGNLEQGTWAIVRRAVHDRLDR
101 EGRAPAFVINGPIAQAMDKALATARDKLHKMESSSGLYEAIAELPNRQFE
151 VIVLRYILGYPTSKVAWYVGIDERTVGHHLRRGKERLRIKLGLPDERKKP
201 KQRREA

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more