ECF proteins of ECF group ECF130

Displaying ECF 101 - 120 of 130 in total

>ECFp116127 ECF130 ECF130s4 Streptomyces sp. EN16

1 MTRNRGRDASGVPPVTTDRPDLSFTAFHQMNRASYVRYAETYLRHRQDAE
51 EAIDSAFEHLLRTWDQVLLTENPAAYAWTITRNKVIDHARARTRRPPLID
101 DAAFDTVALRDAVDPIGQITESLALFRALRQLTDRQQDVMVMTYLQGMNA
151 TEVAAVLGMSSPTVRSTVRHSLRRLREILGPDRTMEGRR

>ECFp151401 ECF130 ECF130s4 Streptomyces sp. MnatMP-M77

1 MTRNRSRTASGVPPVTTDRPDLSFTAFHQMNRPSYVRYAETYLRHRQDAE
51 EAIDSAFEHLLRNWDQVLLTENPAAYAWTITRNKVIDHARARTRRPPLIE
101 DAAFDTVALRDAVDPIGQITESLALFRALRQLTDRQQDVMVMTFLQGMNA
151 NEVAAVLGMSSPTVRSTVRHSLRRLREILGPDRTMEGRR

>ECFp168599 ECF130 ECF130s4 Streptomyces sp. CB00316

1 MTRNRSRDTSGTPPVTPPGRPDLSFTAFHQMNRPSYVRYAETYLRHRQDA
51 EEAIDSTFEHLLRTWDQVLLTENPAAYAWTIMRNKVTDHARARTRRPPLI
101 DEAAFNTVALRDAVDPIGQITESLALFRALRQLTDRQQDVMVMIYLQSMN
151 APEAAAVLGMTSATVRSTVRHSLRRLREILGPDRTMEGQR

>ECFp163496 ECF130 ECF130s4 Streptomyces sp. CB02130

1 MTRSRSRKTPATPAVTAAERPDLSFTAFHQMNRASYVRYAETYLRHRQDA
51 EEAIDSTFEHLLRTWDEVLLTENPAAYAWTIMRNKVTDHARARTRRPPLI
101 DEAAFNTVALRDAVDPIGQITESLALFRALRQLTDRQQDVMVMIYLQGMN
151 APEVAAVLGMTSATVRSTVRHSLRRLREILGPDRTMEGQR

Name Aliases LCA Taxa Group Subgroup
ECFp161479
  • RNA polymerase subunit sigma-24
  • AMK09_34065
Streptomyces sp. CB02488 ECF130 ECF130s4

>ECFp161479 ECF130 ECF130s4 Streptomyces sp. CB02488

1 MAQQLPDLSFTAFHQMNRPRYIHYAETFLHNRHDAEEAIDSAFEQLLRTW
51 DKVLLVENPSGYAWTVMRNKVNDHSRARRRRPPLLDDEAFNTFALRDAVD
101 PYGQITETLALMRAMRQLTERQLDVMVMTYLHGLNAPEVADVLGITSATV
151 RSTVRHATRRLRDILGPDRAMEGRR

>ECFp163799 ECF130 ECF130s4 Streptomyces sp. TSRI0395

1 MTRNRGRDSSGIPPVTTDRPDLSFTAFHQMNRASYVRYAETYLRHRQDAE
51 EAIDSAFEHLLRTWDQVLLTENPAAYAWTVTRNKVIDHARARTRQPPLIE
101 DAAFDTVALRDAVDPIGQITESLALFRALRQLTDRQQDVMVMTYLQGMNA
151 PEVAAVLGMSSPTVRSTVRHSLRCLREILGPDRTMEGRR

>ECFp166478 ECF130 ECF130s4 Streptomyces sp. CB00072

1 MTRNRGRDASGVPPVTTDRPDLSFTAFHQMNRASYVRYAETYLRHRQDAE
51 EAIDSAFEHLLRTWDQVLLTENPAAYAWTVMRNKVIDHARARTRRPPLIE
101 DAAFDTVALRDAVDPIGQITESLALFRALRQLTDRQQDVMVMTYLQGMNA
151 TEVAAVLGMSSPTVRSTVRHSLRRLREILGPDRTMEGRR

>ECFp151855 ECF130 ECF130s4 Streptomyces sp. OspMP-M43

1 TRNRSRTASGVPPVTTDHPDLSFTAFHQMNRPSYVRYAETYLRHRQDAEE
51 AIDSAFEHLLRNWDQVLLTENPAAYAWTITRNKVIDHARARTRRPPLIED
101 AAFDTVALRDAVDPIGQITESLALFRALRQLTDRQQDVMVMTFLQGMNAN
151 EVAAVLGMSSPTVRSTVRHSLRRLREILGPDRTMEGRR

>ECFp81289 ECF130 ECF130s4 Streptomyces nanshensis

1 MTRNRRRNTPNAPAVTAADRPDLSFTAFHQMNRPSYVRYAETYLRHRQDA
51 EEAIDSTFEHLLRTWDQVLLTENPAAYAWTIMRNKVTDHARARTRRPPLI
101 DEAAFNTVALRNAVDPIGQITESLALFRALRQLTNRQQDVMVMTYLQGMN
151 APEAAAVLGMTSATVRSTVRHSLRRLREILGPDRTMEGQR

>ECFp82275 ECF130 ECF130s4 Streptomyces sp. ERV7

1 MTNQQLPVDFSAFHHMHRPVYLRWAQTVLNHRADAEEAVDAAFEQLLMIW
51 TVVLSKENPAAYAWSVLRSRTLDLARARRRRPALLEAAAFETVALARACD
101 PIGQLEESLALFHAVRQLPPRQMDVMLLLHLHGLTPAQVGDHLGITAAAV
151 RSTARHAKRRLRHTLGPAAQHTEEGHADDIAH

Name Aliases LCA Taxa Group Subgroup
ECFp92013
Streptomyces griseus ECF130 ECF130s4

>ECFp92013 ECF130 ECF130s4 Streptomyces griseus

1 MTRNRRRNNPTAPAVTAADRPDLSFTAFHQMNRASYVRYAETYLRHRQDA
51 EEAIDSTFEHLLRTWDQVLLTENPAAFAWTVMRNKVTDHARARTRRPPLI
101 DEAAFNTVALRDAVDPIGQITESLALFRALRQLTDRQQDVMVMTYLQGMN
151 APEAAAVLGMTSATVRSTVRHSLRRLREILGPDRTMEGQR

>ECFp92967 ECF130 ECF130s4 Streptomyces sp. MNU77

1 MTRNRGRDASGVPPVTTERPDLSFTAFHQMNRASYVRYAETYLRHRQDAE
51 EAIDSAFEHLLRNWDQVLLTENPAAYAWTVTRNKVIDHARARTRRPPLIE
101 DAAFDTVALRDAVDPIGQITESLALFRALRQLTDRQQDVMVMTYLQGMNA
151 PEVAAVLGMSSPTVRSTVRHSLRRLREILGPDRTMEGRR

>ECFp93234 ECF130 ECF130s4 [Kitasatospora] papulosa

1 MIQQQPPDHAFTAFHQMKRPSYVRYAETFLHNRDDAEEAVDSTFEHLYRC
51 WDKVLSSDNSDGYAWTIMRNKVTDHARARNRRPLLLDDEAFNTVALRDAV
101 DPFGQITESLALMRAMRLLTERQLDVMVMTYLHGLKAAEVADALGVTSAT
151 VRSTVRHAARRLRSILGPDRTMEGRR

>ECFp94821 ECF130 ECF130s4 Streptomyces sp. W007

1 MTRNRGRDASGVPPVTTDRPDLSFTAFHQMNRASYVRYAETYLRHRQDAE
51 EAIDSAFEHLLRTWDQVLLTENPAAYAWTVTRNKVIDHARARTRRPPLIE
101 DAAFDTVALRDAVDPIGQITESLALFRALRQLTDRQQDVMVMTYLQGMNA
151 TEVAAVLGMSSPTVRSTVRHSLRRLREILGPDRTMEGRR

Name Aliases LCA Taxa Group Subgroup
ECFp98135
Streptomyces niveus ECF130 ECF130s4

>ECFp98135 ECF130 ECF130s4 Streptomyces niveus

1 MDRHPHALPLDFAAFHQMHRTGYVRYAKSFLHNWADAEEATDAAFERIYR
51 QWSRVLASENHEAYAWQILRNQVHDHERARRRRPLLDAAAFDTAALRETT
101 DPIGQLTESLTLLRAFRELTDRQQDVMVLLHLHDLTPAEIADELGIAAAT
151 VRSTARYARLRLAAILDPGHTSKGHTDDLAR

>ECFp116343 ECF130 ECF130s5 Streptomyces sp. NRRL B-1140

1 MSHDDAQEPSAQEHGLGLSQSMYVPLDLPIDFEAFYLAHQEAFHAYAEVH
51 FGTRAAAEEVIHEVFLEIHAGWTELLGSGHVEQGAWAIVRRAVRDRLESE
101 GRAPAFIINGPIAQALAATKDRLERMQSTTGLYEAIAELPNRQFEVIVLR
151 YLLGYPTSRVAWFMGIDERTVGHHLRRGKERLRVKLGLPDDRKKPKHKQK
201 GE

>ECFp106123 ECF130 ECF130s5 Streptomyces canus 299MFChir4.1

1 MRYDDAPEGASPAEHRAGLSQSMFVALDLEVDFEAFYLGHHEVFHAYAEV
51 HFGNRETAEEVIHEVFLEIHAGWSQLLSAGNLEQGAWAIVRRIVHNRLDA
101 EGRGPAFVINGPIAQALDTALVTARDKLQKMESATGLYEAIADLPDRQFE
151 VIVLRYVLGYPTAKVAWYIGIDDRTVGHHLRRAKERLRLRLGLPETPKKS
201 KHKGVGA

>ECFp148237 ECF130 ECF130s5 Streptomyces sp. MnatMP-M17

1 MNDDDVPDGAPELRPQLTPVHVPLDLPLDYEALYLGYQEAFHAYAEVHFG
51 SREAAEEVIHKAFLEILGGWDELLRAGNLEQGAWAIVRRAIDDQLKREGR
101 APAFVINGPIAQALRATRDKLKVMESSTGLYAAIAALPARQFEVIVLRYI
151 LGYPTAKVAWYVGVDARTVGHHIRRGRERLRVVLDLPPDTRKTEGGGQT

>ECFp166636 ECF130 ECF130s5 Streptomyces sp. MP131-18

1 MTNGASEDGRPPEPGPARRANTPVETPLDLPLEAEAFYLTHQEMYHAYAQ
51 AQLGDRRSAEEAVHMAFVEIIDHWDELLRERNLGRCAWAIVRRTVSEQLE
101 RQRRPAAFILNGAVQQALRATRDQFRVMHSSMGLYAAMAELPPRQFDVIV
151 LRYVLGYSTRRIAWFMDLHERTVDHHVRRAKEHLRVCLGLPDGLSKQDAQ
201 QAAQQDSQQDEDNGGQRG

>ECFp78577 ECF130 ECF130s5 Streptomyces sviceus ATCC 29083

1 MRYDDAQEGASPAEHRAGLSQSMFVALDLEVDFEAFYLGHHEVFHAYAEV
51 HFGNRETAEEVIHEVFLEIHAGWSQLLSAGNLEQGAWAIVRRIVHNRLDA
101 EGRGPAFVINGPIAQALDTALVTARDKLQKMESASGLYEAIADLPDRQFE
151 VIVLRYVLGYPTAKVAWYIGIDDRTVGHHLRRAKERLRLKLGLPETPKKS
201 KHKGVGA

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more