ECF proteins of ECF group ECF130

Displaying ECF 81 - 100 of 130 in total

>ECFp116522 ECF130 ECF130s2 Streptomyces yangpuensis

1 MAGWSITDERSYWAFHDDRYTPFLGFAYRKLGSDADAEDAADKTFDEIMN
51 NWQRMLGMENLRGYAWSILKSRISDQRRKRDKQALPTDLAAFAAMVDHRD
101 DFAVVLGRLQFARAVGHLSERQRDAVTLRHGLELDTATAAQLMGVAEATV
151 RSLLSQARARLLQVLDIPSDDGKVRS

>ECFp147204 ECF130 ECF130s2 Streptomyces mirabilis

1 MNGDGGTEETSGAVGAPRAVPIDQWDPTVQMAYWGFHHQRRQDYMRYAYL
51 QLGSDADAEEAVDLTFDQVMDRWPRMLRMENLEGYAWTILKRRIIDMHRK
101 RRRRPELMEIAAFEAALADPAEDPYDTLTDAIALYVAVGSLSERQRDAIL
151 LYYGIGFTAAEAAVLMGNEEATVRSQLRTGRRRLATLLKLRCPEHSDGKN
201 P

Name Aliases LCA Taxa Group Subgroup
ECFp151735
  • H340_16646
  • ECF subfamily protein RNA polymerase sigma-24 subunit
  • ... more
Streptomyces mobaraensis NBRC 13819 = DSM 40847 ECF130 ECF130s2

>ECFp151735 ECF130 ECF130s2 Streptomyces mobaraensis NBRC 13819 = DSM 40847

1 MERWPDADRLSFWAFHLARRRDYMRFAYARLGSDADAEEAVDLAFEAVMH
51 SWPRMLRMAHLEQYAWTILKHRICDQWRRRRRRPEPMDTDAFEAALRDQA
101 EDPYELLADFIQLNEAISGLSERQRDAVVLRYRIGYTTSEAAELLGIEEA
151 TVRSHVSQACRRLARVLRTGVTGAPRGEGTPGAPGAPEATADTAPREETP

>ECFp164508 ECF130 ECF130s2 Streptomyces sp. CB02056

1 MRARYLEWAYLQLGSDADAEDAVDATFDKLADKWCQMLRMDNLPGYAWKV
51 LKHRVVDQARMRGRRAAPMDIAAFEAALTTMSHDPFEDLAEALAAYHEIR
101 RLPERQRDVMELRSCLGFTTEEVADLMGVKDATIRSHMSQARQRLAARLR
151 EDVEGTADGEKQ

>ECFp77944 ECF130 ECF130s2 Streptomyces sp. WM6372

1 MPLPSRRRQPTPMSQWDPTARLSYWAFHADRRPSYMRFAYLQLGSDAAAE
51 DAVDATFDSIMNEWLRMLHMDRLDAYAWTILKQRLVDRQQRRGAHGAWPS
101 EPTAPEPMDISAFEAALKEARADQQCEVLTDTIRFYSAVSRLAERQRDAV
151 LLRYGLQCTPGEAASVMGVDEATVRSQLGQAHRRLARMLDASAEPADSAG
201 RADSAGSPES

>ECFp78122 ECF130 ECF130s2 Streptomyces olivochromogenes

1 MNGDGGPEETGGAVGTPRVVPIDQWDPTVQMAYWGFHHQRRQDYMRYAYL
51 QLGSDADAEEAVDLTFDQVMDRWPRMLRMENLEGYAWTILKRRIIDMHRK
101 RRRRPELMEIAAFEAALADPAEDPYDTLTDAIALYVAVGSLSERQRDAIL
151 LYYGIGFTAAEAAVLMGNEEATVRSQLRTGRRRLATLLKLRCPEHSDGKN
201 P

>ECFp78283 ECF130 ECF130s2 Streptomyces

1 MGLPSRRRRPTPMSQWDPTARLSYWAFHANRRPAYMRFAYLQLGSDGAAE
51 EAVDAAFDSIMGEWLRMLHMDRLDAYAWTVLKQCLIDRQRRRHPWQPPPE
101 PMDISAFEAALKEAHADRYEVLTDTIRFYSAVSRLVERQRDAVLLRYGLQ
151 CTPGEAAAVMGVDEATVRSHLGQAHRRLARLLDTSAGAPESAESAES

Name Aliases LCA Taxa Group Subgroup
ECFp78708
Streptomyces sp. C ECF130 ECF130s2

>ECFp78708 ECF130 ECF130s2 Streptomyces sp. C

1 MGLPSRRRQPTPMSQWDPTARLSYWAFHTNRRPAYMRFAYLQLGSDAAAE
51 DAVDATFDSIMHEWLRMLHMDRLDAYAWTVLKQRIVDWQQRRDPRLRRPE
101 PMDISAFEAALKEAHADQYEVLTDTIRFYSAVSRLAERQRDTVLLRYGLQ
151 CTPGEAAAVMGVDEATVRSQLGQAHRRLARLLDTSAGS

>ECFp81300 ECF130 ECF130s2 Streptomyces sp. NRRL F-2664

1 MGLPSRRRRPTPMSQWDPAARLSYWAFHANRRPVYMRFAYLQLGSDTDAE
51 EAVDATFDSIMGDWLRMLHMDRLDAYAWTVLKHCLVDRRQRRHPWQQEPE
101 PMDISAFEAALKEAHADQYEVLTDTIRFYSAVSRLAERQRDTVLLRYGLQ
151 CTPGEAASVMGVDEPTVRSYLGQAHRRLARLLDTCADPADASEPAEPAGS

Name Aliases LCA Taxa Group Subgroup
ECFp84420
Streptomyces katrae ECF130 ECF130s2

>ECFp84420 ECF130 ECF130s2 Streptomyces katrae

1 MGLPSRRRQPTPMSQWDPTARLSYWAFHSNRRPAYMRFAYLQLGSDTDAE
51 DAVDATFDSIMHEWLRMLHMDRLDAYAWTVLKQRIVDWQQRRDPRLRRPE
101 PMDISAFEAALKEAHPDQYEVLTDTIRFYQAVSRLAEGQRDTVMLRYGLQ
151 CTPGEAAAVMGVDEATVRSQLGQAHRRLARLLDAVPES

>ECFp85150 ECF130 ECF130s2 Actinobacteria bacterium OK006

1 MNGDGGPEETGGAVGAPRAVPIDQWDPTVQMAYWGFHHQRRQDYMRYAYL
51 QLGSDADAEEAVDLTFDQVMDRWPRMLRMENLEGYAWTILKRRIIDMHRK
101 RRRRPELMEIAAFEAALADPAEDPYDTLTDAIALYVAVGSLSERQRDAIL
151 LYYGIGFTAAEAAVLMGNEEATVRSQLRTGRRRLATLLKLRCPEHSDGKN
201 P

>ECFp86048 ECF130 ECF130s2 Streptomyces sp. NRRL S-495

1 ADAEEAVDATFDAITDNWDQMLQMQNLPGYAWTVLKHRVVDQMRRQGRRA
51 MPMDHAAFDAAVATRTHDPFQDLAETLAAFQELRRLPERQRDVMELCACL
101 GFTAEEAADLMGVERATIRSHIRQARQRLADRLREDVEGPEGETQ

>ECFp90085 ECF130 ECF130s2 Streptomyces sp. PsTaAH-124

1 MSGDTGPEETGGAVGAPRAVPIDQWDMTAQMAYWGFHQQRRTDYMRYAYL
51 QLGSDGDAEEAVDLTFDAVMDCWPRMLEMENLEGYAWTILKRRIIDMHRK
101 RRRRPELMETAAFEAAVADQLADDPYDALTDAIALYTAVASLSERQRDAI
151 LLHYGMGFTAAEAATVMGNEEATVRSQLRTGRKRLAHMLKLRCPERPNGK
201 KHS

Name Aliases LCA Taxa Group Subgroup
ECFp95818
Streptomyces katrae ECF130 ECF130s2

>ECFp95818 ECF130 ECF130s2 Streptomyces katrae

1 MGLPSRRRRPTPMSQWDPTARLSYWAFHANRRPSYMRFAYLQLGSDTAAE
51 DAVDATFDSIMNEWLRMLHMDRLDAYAWTILKQRLVDRQQRRSTWPEPMD
101 ISAFEAALKEAHADQYEVLTDTIRFYSAVSRLAERQRDAVLLRYGLQCTP
151 GEAASVMGVDEATVRSQLGQAHRRLARLLDTSAAS

>ECFp95961 ECF130 ECF130s2 Streptomyces sp. RSD-27

1 MGLPSRRRQPTPMSQWDPTARLSYWAFHSNRRPAYMRFAYLQLGSDADAE
51 DAVDATFDSIMHEWLRMLHMDRLDAYAWTVLKQRIVDWQQRRDPRLRRPE
101 PMDISAFEAALKEVHPDQYEVLTDTIRFYQAVARLAERQRDTVVLRYGLH
151 CSPGEAAAVMGVDEATVRSQLGQAHRRLARLLDAAPES

Name Aliases LCA Taxa Group Subgroup
ECFp96746
Streptomyces sp. C ECF130 ECF130s2

>ECFp96746 ECF130 ECF130s2 Streptomyces sp. C

1 MRWGTVNDGGPEESGGAVGLPSRRRQPTPMSQWDPTARLSYWAFHTNRRP
51 AYMRFAYLQLGSDAAAEDAVDATFDSIMHEWLRMLHMDRLDAYAWTVLKQ
101 RIVDWQQRRDPRLRRPEPMDISAFEAALKEAHADQYEVLTDTIRFYSAVS
151 RLAERQRDTVLLRYGLQCTPGEAAAVMGVDEATVRSQLGQAHRRLARLLD
201 TSAGS

>ECFp99329 ECF130 ECF130s2 Streptomyces sp. XY332

1 MGLPSRRRRPTPMSQWDPTARLSYWAFHANRRPSYMRFAYLQLGSDTAAE
51 DAVDATFDSIMNEWLRMLHMDRLDAYAWTILKQRLVDRQQRRSTWPEPMD
101 ISAFEAALKEAHSDQYEVLTDTIRFYSAVSRLAERQRDAVLLRYGLQCTP
151 REAASVMGVDEATVRSQLGQAHRRLARLLDTSAES

>ECFp113275 ECF130 ECF130s2 Streptomyces

1 MPSRRRRPTPMSQWGPAARLSYWAFHANRRPSYMRFAYLQLGSDAAAEDA
51 VDATFDALMSEWLRMLHMDRLDAYAWTVLKQRLADRQQRRSPWPRPMDIS
101 AFEAALKEAHADRYEVLTDTIRFYSAVSRLAERQRDAVVLRYGLQCSPGE
151 AAAVMGVDEATVRTHLGQAHRRLARLLDTSAES

>ECFp165737 ECF130 ECF130s4 Streptomyces sp. CB02366

1 MTRNRSHAASGVPPVTTDRPDLSFTAFHQMNRASYVRYAETYLRHRQDAE
51 EAIDSAFEHLLRTWDQVLLTENPAAYAWTITRNKVIDHARARRRRPPLID
101 DAAFDTVALRDAVDPIGQITESLALFRALRQLTDRQQDVMVMTYLQGMNA
151 TEVAAVLGMSSATVRSTVRHSLRRLREILGPDRTMEGQR

Name Aliases LCA Taxa Group Subgroup
ECFp113194
Streptomyces regalis ECF130 ECF130s4

>ECFp113194 ECF130 ECF130s4 Streptomyces regalis

1 MSQDLPSQASRAPRMKKLPPDFEAFHQMYRPLYVNWAKSRLGNWHDAEEA
51 VDAAFEHLLKAWSTVLTKENPTAYAWRVIRNSTIDHSRTRDRLPALIGEA
101 FETLALTQAVDPISQLEESLNLYAEIGQLPPRQMDVAFLHFGLGYSAVEI
151 AAALGITPAGVRSTVRHAKRRLQHAYGVKKNLTKPRTAEEGHAEEGKAEE
201 GKADDIAH

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more