ECF proteins of ECF group ECF130

Displaying ECF 61 - 80 of 130 in total
Name Aliases LCA Taxa Group Subgroup
ECFp104821
  • hypothetical protein
  • SNOD_00190
  • ... more
Streptomyces nodosus ECF130 ECF130s3

>ECFp104821 ECF130 ECF130s3 Streptomyces nodosus

1 MSEADQGTDFEAFVLETSEAFSRVARAEARGDLHSAEDAVQVVYMRMFSS
51 WEKIVAGSGNRAAYGRTAVRNAVKDQFRRSQRTISFPLQELPDQESQTGI
101 PGAAYEVIKEGIDDLVSKLPDRQRQVITLCVLQEMSPEEAGKRLRLKEES
151 VKSYIRMAIKNLKKFVNETGEEATA

>ECFp147561 ECF130 ECF130s3 Streptomyces sp. MUSC 1

1 MSEAAPGADFESFVLETIEAFSRLARVEAGDLHSAEDAVQDVYLNMYRRW
51 ATISAQEGSLTAYGRIAVKRAVIDQFRRHKRMVTVPVHELPEMESGIGIP
101 EAAYEIIKEGIGELVSSLPERQREVITLCVLQDLSPAVVAQRLQIKEESV
151 KRYIKAAANNLKKSINEHSEEATA

>ECFp107960 ECF130 ECF130s3 Streptomyces sp. NRRL WC-3795

1 MTEADRGTDFEAFVLETSAAFDRVARAEAGGDLHSAEDAVQVAYMRMFTS
51 WEKIVARPGDRAAYGRTAVRNAVIDQFRRNRRIIPAPLQELPEQESRIGI
101 PDAAYEMIKEGIDELVAKLPDRQRQVITLCVLQDISPEDAGKRLRLKEES
151 VKSYIRMAVKNLKKYVNETGEEGTA

>ECFp165687 ECF130 ECF130s3 Streptomyces phaeoluteigriseus

1 MSEAALGADFESFVLETIEAFSRLARAQAGDLHSAQDAVQDVYLNMYRRW
51 DFLTAGTGSLTAYGRTAVKRAVIDQFRRNKRMVMVPVHELPEKESGIGVP
101 EAAYEMIKEGIDELVKSLPERQCEVITLCILQDLSPDVVAQRLQIKEESV
151 KRYIKAAANNLKKSINEHSEEVTV

>ECFp113210 ECF130 ECF130s3 Streptomyces sp. CNQ766

1 MTEPDRGTDFEAFVLETSAAFSRVARAEASGDLYSAEDAVQVAYMRMFTS
51 WEKIVARPGDRAAYGRTAVRHAVIDQFRRNQRMAPTPLQELPEQESRIGI
101 PDAAYEMIKEGIDELVAKLPDRQRQVITLCILQDVSPEDAGKRLRLKEES
151 VKRNIRMAIKNLKKYVNESGEEGTG

>ECFp114124 ECF130 ECF130s3 Streptomyces

1 MTEPDRGTDFEAFVLETSAAFSRVARAEAGGDLHSAEDAVQVAYMRMFTS
51 WEKIVARPGDRAAYGRTAVRNAVIDQFRRNQRITPAPLQDLPEQESQIGI
101 PDAAYEMIKEGIDELVAKLPDRQRQVITLCVLQDISPEDAGKRLRLKEES
151 VKSYIRMAIKNLKKYVNETGEEGTA

Name Aliases LCA Taxa Group Subgroup
ECFp78887
  • hypothetical protein
  • ADL00_RS42580
Streptomyces sp. AS58 ECF130 ECF130s3

>ECFp78887 ECF130 ECF130s3 Streptomyces sp. AS58

1 MTEPDRGTDFEAFVLETSAAFSRVARAEAGGDLHSAEDAVQVAYMRMFTS
51 WEKIVARPGNRAAYGRTAVRNAVIDQFRRNQRMVPAPLQELPEQESQIGI
101 PDAAYEMIKEGIDELVAKLPDRQRQAITLCVLQDLSPEEAGRRLGLKEES
151 VKKYIRMAIMNLKKFVNETGEEETA

>ECFp80716 ECF130 ECF130s3 Streptomyces hygroscopicus subsp. hygroscopicus

1 MTEPDRGTDFAAFVLETSAAFSRVARAEAGGDLHSAEDAVQVAYMRMFTS
51 WEKIVARPGNRAAYGRTAVRHAVIDQFRRNQRVTPALSQELPEQESRIGI
101 PDAAYEMIKEGIDELVTKLPDRQRQVITLCVLQDISPEDAGKRLRLKEES
151 VKSYIRMAVKNLKKYVNETAEEGTA

>ECFp87709 ECF130 ECF130s3 Streptomyces canus 299MFChir4.1

1 MSEGAPGADFESFVLDTIEAFSRLARAKAGDLHSAQDAVQDAYLNMYRQW
51 EKISARQESLTALGRIVVHHAVIDQFRRNKRMVTVPMPVQEMPDTQSGIG
101 VPEAAYEMVKEGIDELVARLPERQREVITLCVLQDLSPAVVAQRLQIKEE
151 SVKRYIKAAANNLKKSINESSEEVTA

>ECFp88000 ECF130 ECF130s3 Streptomyces ahygroscopicus subsp. wuyiensis

1 MSEAAPGADFESFVLETIEAFSRLARVEAGDLHSAEDAVQDVYLNMYRRW
51 ATISAQEGSLTAYGRTALKRAVIDQFRRNKRMVTVPVHELPEMESGIGIP
101 EAAYEMIKEGIGELVSRLPERQCEVITLCVLQDLSPAVVAQRLQIKEESV
151 KRYITAAANNLKKSINEHSEEATA

>ECFp91852 ECF130 ECF130s3 Streptomyces sp. NRRL WC-3753

1 MTEADRGTDFEAFVLETSAAFSRVAQAEAGGDLHSAEDAVQVAYMRMFTS
51 WEKIVARPGNRAAYGRTAVRNAVIDQFRRNQRMTPAPLQELPEQESRIGI
101 PDAAYEMIKEGIDELVAKLPDRQRQVITLCVLQDISPEDAGKRLRLKEES
151 VKRNIRMAINNLKKFVNETGEEETV

>ECFp93163 ECF130 ECF130s3 Kitasatospora aureofaciens

1 MSEAVWGVDFESFVLETLEAYSRLARAQAGDLHSAEDAVQDVYLNMYRRW
51 EELSTRQGSLTAYGRMAVKNAVISQFRKNRRMVPAPVQELPEHESGIGIP
101 DAAYEIFKEGIDELIADLAERQRQVITLCILQDLSPAVVAKRLRIREESV
151 KRYVKAAANNLKKSIHESSEEVTA

Name Aliases LCA Taxa Group Subgroup
ECFp93957
Streptomyces canus ECF130 ECF130s3

>ECFp93957 ECF130 ECF130s3 Streptomyces canus

1 MTEADRGTDFEAFVLETSAAFSRVAQAEAGGDLHSAEDAVQVAYMRMFTS
51 WEKIVARPGNRAAYGRTAVRNAVIDQFRRNQRMTPAPLQELPEQESQIGI
101 PDAAYEMIKEGIDELVAKLPDRQRQVITLCVLQDISPEDAGKRLRLKEES
151 VKRNIRMAINNLKKFVNETGEEETV

Name Aliases LCA Taxa Group Subgroup
ECFp109168
  • hypothetical protein
  • AA958_34210
  • ... more
Streptomyces sp. CNQ-509 ECF130 ECF130s3

>ECFp109168 ECF130 ECF130s3 Streptomyces sp. CNQ-509

1 MTEPDRGTDFEAFVLETSAAFSRVARAEASGDLHSAEDAVQVAYMRMFTS
51 WEKIVARPGDRAAYGRTAVRHAVIDQFRRNQRMAPTPLQELPEQESRIGI
101 PDAAYEMIKEGIDELVAKLPDRQRQVITLCILQDVSPEDAGKRLRLKEES
151 VKRNIRMAIKNLKKYVNESGEEGTG

>ECFp105645 ECF130 ECF130s2 Streptomyces sp. NRRL S-241

1 MSQWDPTARLSYWAFHANRRPAYMRFAYLQLGSDGAAEEAVDAAFDSIMG
51 EWLRMLHMDRLDAYAWTVLKQCLIDRQRRRHPWQPPPEPMDISAFEAALK
101 EAHADRYEVLTDTIRFYSAVSRLVERQRDAVLLRYGLQCTPGEAAAVMGV
151 DEATVRSHLGQAHRRLARLLDTSAGAPESAGSAESAESAES

>ECFp107487 ECF130 ECF130s2 Streptomyces sp. NRRL S-444

1 MPSRRRRPTPMSQWDPTARLSYWAFHANRRPSYMRFAYLQLGSDTAAEDA
51 VDATFDSIMNEWLRMLHMDRLDAYAWTILKQRLVDRQQRRRTWPEPMDIS
101 AFEAALKEAHSDQYEVLTDTIRFYSAVSRLAERQRDAVLLRYGLQCTPRE
151 AASVMGVDEATVRSQLGQAHRRLARLLDTSAES

>ECFp112156 ECF130 ECF130s2 Streptomyces lavendulae subsp. lavendulae

1 MGLPSRRRQPTPMSQWDPTARLSYWAFHANRRPPYMRFAYLQLGSDAAAE
51 DAVDAAFDSIMNEWHRMLHMDRLDAYAWTVLKRRIVDWQRRPGPRRHRPE
101 PMDISAFEAALKEAHADRYEALTDTIRFYSAVSRLAERQRDAVMLRYGLQ
151 CTPGEAASVMGVDEATVRSQLGQAHRRLARLLDASAGS

Name Aliases LCA Taxa Group Subgroup
ECFp113355
  • hypothetical protein
  • IF43_RS38690
Streptomyces sp. NRRL S-87 ECF130 ECF130s2

>ECFp113355 ECF130 ECF130s2 Streptomyces sp. NRRL S-87

1 MAFWAFHGKSLHTYLRYAYLQLGSDADAEEAVDRAFDSVMQAWPRMLTME
51 RPEAYAWAILKHRIADQQRGRKRNPQPMDIAAFDTAAAAVGQDPYEVLAD
101 RIQFYAAVGRLSERQRDAVVLRYGLDLTTRDTARLMGVEEASVRSLLRLA
151 RTRLADLLHVSEGDVPQPG

>ECFp114514 ECF130 ECF130s2 Streptomyces sp. NRRL S-244

1 MPLPSRRRRPTPMSQWDPTARLSYWAFHANRRPSYMRFAYLQLGSDAAAE
51 DAVDATFDSIMNEWLRMLHMDRLDAYAWTILKQRLVDRQQRRGARGAFPA
101 EPTVPEPTTSEPTTSEPTAPEPMDISAFEAALKEARADEQCEVLTDTIRF
151 YSAVSRLAERQRDAVLLRYGLQCTPGEAASVMGVDEATVRSQLGQAHRRL
201 ARMLDASAEPADAAECADPAESPES

>ECFp116061 ECF130 ECF130s2 Streptomyces diastatochromogenes

1 MNGDGGPEETGGAVGAPRAVPIDQWDPTVQMAYWGFHHQCRQDYMRYAYL
51 QLGSDADAEEAVDLTFDQVMDRWPRMLRMENLEGYAWTILKRRIIDMHRK
101 RRRRPELMEIAAFEAALADPAEDPYDTLTDAIALYVAVGSLSERQRDAIL
151 LYYGIGFSAAEAAVLMGNEEATVRSQLRTGRRRLATLLKLRCPEHSDGKN
201 P

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more