ECF proteins of ECF group ECF130

Displaying ECF 41 - 60 of 130 in total

>ECFp82113 ECF130 ECF130s1 Actinobacteria bacterium OV320

1 MTQEELRPAGNPRAPEKLPLDFSAFHQMHRPRYVREAERCLRRRADAEEA
51 VDEAFVQLARQWPQILSAENPAAYAWRVMKNRVVDHARARGRRATLMDTA
101 VFETVTLQSAEDAFEVIEQNLRLFRAISALPERQRDVIRLRYCEGYSTAD
151 VAFQLGITEAGVRSTERYAKRRLREIYTSDAEEEAERS

>ECFp82322 ECF130 ECF130s1 Streptomyces

1 MPADFRAFHQLYRAGYIRYAELHLESRADAEEAVDLAFEQLMLAWQTVLR
51 QPVPEAYAWRVVKNRTIDHARARGRRPVVVDVAAFETLSLRHALDPISEL
101 EESLTLYQTLASLPERQRDVMLLRYALGYATKETARLMGITEAGVRSTIR
151 YALRRLRQAFGLEEGEDDARLAD

Name Aliases LCA Taxa Group Subgroup
ECFp84102
  • RNA polymerase subunit sigma-24
  • SXIM_RS12630
Streptomyces ECF130 ECF130s1

>ECFp84102 ECF130 ECF130s1 Streptomyces

1 MVPLPADLRAFHQLYRPAYVRWAELYLGDRPGAEDVVDAAFEQLAEDWGE
51 ALRLDSPAGYAWTILRSRTLEAARARGRRPVVMDTAAFETAALRDAVDPV
101 GELEESLSIYQAIRELPERQHDVIVLLYCLGYGVQETADVLGISVPGVRS
151 TARYARRRLKEALGLDREGGSGDLTDLAD

Name Aliases LCA Taxa Group Subgroup
ECFp84260
  • RNA polymerase, sigma-24 subunit, RpoE, ECF subfamily
  • OK074_3596
Actinobacteria bacterium OK074 ECF130 ECF130s1

>ECFp84260 ECF130 ECF130s1 Actinobacteria bacterium OK074

1 MTREESSLRPAGPPREVDKLPLDFSAFHALHRARYVREAERCLRCRADAE
51 EAVDEAFTQLALDWPRILRADNPAGYAWRVVKNRITDHARARGRRAALMD
101 TAAFETVTLAGAEDPFEVIEQNLRLFHAISTLPERQREVVVLRYCEGYST
151 AEVAFHLGITEAGVRSVERYAKRRLREFYAPSATDRADKADTADKAGKAD
201 KEEEERP

>ECFp85958 ECF130 ECF130s1 Streptomyces agglomeratus

1 MTTKLPVDFSAFHQMHRPAYIRWAETILNNRSDAEEAVDAAFEQLLKVWP
51 DVLTKENPAGYAWRVLRNITIDTGKARGRRPVLLDMAAFETAALLQAVDP
101 IGQLEESMNLFRIIGELPPRQMDVMLLLHANDLSVDQVAAELGITPAGVR
151 SNARHAKRRLRQTLGLDAANLEEGHADDIAR

>ECFp87208 ECF130 ECF130s1 Streptomyces rimosus subsp. rimosus

1 MGLPADFRAFHQLYRAGYIRYAELYLKSRADAEEAVDLAFEQLMLAWPTV
51 LRQAVPEAYAWRVVKHRTIDHARARGRRPVVVDVAAFETHSLRHALDPIS
101 ELEESLTLYQTLAALPERQRDVMLLRYALGYATKETARLMGITEAGVRST
151 IRHALRRLRQAFGLEEGEDDARLAD

>ECFp87280 ECF130 ECF130s1 Streptomyces albus subsp. albus

1 MTGLPDELPVDFRAFHQLHRPAYVHRAASILNNHSDAEEAVDTAFEQLAR
51 DWEKVLAMENPAAYAWTVMKNRAIDLTRARGRRPYLLEAAAFETVALRDA
101 VDPIGQFEESMSLCQAVRDLPERQQDVIILRYFHGYTPTQIATHLGITPA
151 GVRSIDRSARRALHEALDCKGSADDHAH

Name Aliases LCA Taxa Group Subgroup
ECFp93022
  • ECF subfamily RNA polymerase sigma-24 subunit
  • SXIM_25860
Streptomyces xiamenensis ECF130 ECF130s1

>ECFp93022 ECF130 ECF130s1 Streptomyces xiamenensis

1 MPADLRAFHQLYRPAYVRWAELYLGDRPGAEDVVDAAFEQLAEDWGEALR
51 LDSPAGYAWTILRSRTLEAARARGRRPVVMDTAAFETAALRDAVDPVGEL
101 EESLSIYQAIRELPERQHDVIVLLYCLGYGVQETADVLGISVPGVRSTAR
151 YARRRLKEALGLDREGGSGDLTDLAD

>ECFp93966 ECF130 ECF130s1 Streptomyces sp. NRRL F-5755

1 MPVDFRAFHQLYRAGYIRYAELHLESRADAEEAVDLAFEQLMLAWQTVLR
51 QPVPEAYAWRVVKNRTIDHARARGRRPVVVDVAAFETLSLRHALDPISEL
101 EESLTLYQTLASLPERQRDVMLLRYALGYATKETARLMGITEAGVRSTIR
151 YALRRLRQAFGLEEGEDDARLAD

>ECFp94725 ECF130 ECF130s1 Streptomyces aurantiacus

1 MTRLPLDFEAFHRMHRPVYIRWARMYLENHADAEDAVDCAFEQLLVSWPN
51 VLAKESPAAYAWQVMKHRTIDAARARGRREALIDMTAFETAALRQAVDPI
101 GQLEESISLYQAISGLPERQRDVVVLLYSYGLSPAEAADQLGITPAGVRS
151 IARYARRRLREALGLTQEGHADDTH

>ECFp96013 ECF130 ECF130s1 Streptomyces griseoruber

1 MRPTGNPRAPEKLPLDFSAFHQLHRPRYVREAERCLRCRADAEEAVDEAF
51 VQLAREWPQILRAENPAAYAWRVMKNRVVDHARARGRRATLMDTAVFETV
101 TLQGAEDAFEVIEQNLRLFHAISALPERQQDVIRLRYCEGYDTAEVAHEL
151 GITEAGVRSIERYARHRLREIYTSCAEEEAERS

>ECFp98137 ECF130 ECF130s1 Streptomyces rimosus

1 MSEREPSADRDPRPGQARGSHRAPARTPQSATGPQKYPFRPPSTPGPAAT
51 PGAPGAPGTHTLANFGLPADFRAFHQLYRAGYIRYAELHLESRADAEEAV
101 DLAFEQLMLAWQTVLRQPVPEAYAWRVVKNRTIDHARARGRRPVVVDVAA
151 FETLSLRHALDPISELEESLTLYQTLASLPERQRDVMLLRYALGYATKET
201 ARLMGITEAGVRSTIRYALRRLRQAFDLEEGEDDARLAD

Name Aliases LCA Taxa Group Subgroup
ECFp808
  • RNA polymerase subunit sigma-24
  • sig44
  • ... more
Streptomyces bingchenggensis BCW-1 ECF130 ECF130s1

>ECFp808 ECF130 ECF130s1 Streptomyces bingchenggensis BCW-1

1 MTGLPDELPPDFRAFHQLHRGAYIHRAEVYLGNRADAEEAVDEAFEQLAR
51 SWARVLTMENPAAYAWKVMKHRAIDVARARKRGPCLVDNATFETAALRDA
101 IDPIAMLEESLNLYQAIKKLPERQQDVVILLHCRGYTVAQTATHLGITEA
151 GVRSTARYARRRLQQLLETSEGSNADDLAH

Name Aliases LCA Taxa Group Subgroup
ECFp804
  • RNA polymerase subunit sigma-24
  • RNA polymerase, sigma-24 subunit, ECF subfamily
  • ... more
Streptomyces violaceusniger Tu 4113 ECF130 ECF130s1

>ECFp804 ECF130 ECF130s1 Streptomyces violaceusniger Tu 4113

1 MTNEFLRSRETTSMTTGLPADFRAFHQLHRKAYIDRAVVYLGNHADAEEA
51 VDAAFEQLLRCWPKVLSTENPAAYAWKVMKNRAIDLARARNRGPALLDNA
101 TFETAMLRDAVDPIAVLEESLNLYQAIKKLPERQQDVVILLHCRGYSVAE
151 TATHLGITEAGVRSTARYARRRLQQLLAKEDR

>ECFp46656 ECF130 ECF130s1 Streptomyces rapamycinicus NRRL 5491

1 MTNDFPRSREITSMTAGLPADFRAFHQLHRKAYIDRAMVYLGNHADAEEA
51 VDAAFEQLLRCWPKVLTMENPAAYAWKVMKNRVIDLARARNRGPALLDNA
101 TFETAILKNAVDPIAALEESLNLYQAIKKLPERQQDVVILLHCRGYSVAE
151 TATHLGITEAGVRSTARYARRRLQQLLAKDNR

>ECFp142805 ECF130 ECF130s1 Streptomyces

1 MTNDFPRSRETTSMTTGLPADFRAFHQLHRKAYIDRAMVYLGNHADAEEA
51 VDAAFEQLLRCWPKVLTMENPAAYAWKVMKNRVIDLARARNRGPALLDNA
101 TFETAILKDAVDPIAVLEESLNLYQAIKKLPERQQDVVILLHCRGYSVAE
151 TATHLGITEAGVRSTARYARRRLQQLLAKEDR

Name Aliases LCA Taxa Group Subgroup
ECFp106447
Streptomyces pactum ECF130 ECF130s3

>ECFp106447 ECF130 ECF130s3 Streptomyces pactum

1 MSEAVWGVDFESFVLETLEAYSRLARAQAGDLHSAEDAVQDVYLNMYRRW
51 EELSTRQGSLTAYGRMAVKNAVISQFRKNRRMVPAPVQELPEQESGIGIP
101 DAAYEIFKEGIDELIAELPERQRQVITLCILQDLSPAVVAKRLRIKEESV
151 KRYVKAAANNLKKSIHESSEEVSA

>ECFp107666 ECF130 ECF130s3 Streptomyces caeruleatus

1 MSEAATGADFESFVLETIEAFSRLARVEAGDPHSAEDAVQDVYLNMYRRW
51 ATISVQEGSLTAYGRTAVKRAVIDQFRRNKRMVAVPVHELPETESGIGIP
101 EAAYEMIREGIGELVASLPERQREVITLCVLQDLSPAVVAQRLQIKEESV
151 KRYIKAAANNLKKSINEHSEEATA

>ECFp165415 ECF130 ECF130s3 Streptomyces sp. CB00316

1 MSEAAPGADFESFVLETIEAFSRLARAQAGDLHSAQDAVQDVYLNMYRRW
51 DFLTAGQGSLTAYGRTAVKRAVIDQFRRNKRMVMVPVHELPEKESGIGVP
101 EAAYEMIKEGIGELVESLPERQREVITLCILQDLSPDVVAQRLQIKEESV
151 KRYIKAAANNLKKSINDHSEEVTV

>ECFp104704 ECF130 ECF130s3 Streptomyces

1 MSEAAPGADFEAFVLETIEAFSRLARVEAGDLHSAEDAVQDAYLKMYRRW
51 ATISAQEGSLTAYGRTAVKRAVIDQFRRNKRMVAVPVRELPETESGIGIP
101 EAAYEMIKEGIDELVASLPGRQREVITLSVLQDLSPAVVAQRLQIKEESV
151 KRYIKAAANNLKKSINEHSEEATA

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more