ECF proteins of ECF group ECF130

Displaying ECF 21 - 40 of 130 in total

>ECFp167316 ECF130 ECF130s1 Streptomyces paucisporeus

1 MPGRRARRSRVIERPQPVDFTVFHTTHRGAYVRWASLYLGSRADAEDAVD
51 DAMLEMLGKWPTVLSQPEPAAYAWTIVKSRTRDAARARDRRQKVISMAAV
101 MAACLGETIDPIGELETSMAVQQAVEDLPERQHDVFVLRFGLEYTVRETA
151 EHLGITEATVRSTLRDARRRLKAALGLD

>ECFp167407 ECF130 ECF130s1 Streptomyces uncialis

1 MPQAPPLDFSAFHQMHRPAYLRYARAFLRNRADAEEAVDAAFEKLLRKWP
51 QVLRSDSPDRYAWAVLRNHVADHNRGRRPETQPLDEAAFDTVALRTSSDP
101 IAQLEESLTLMRAVRQLPDRQQDVTVLRYLLDLPVDRIADELGISQAAVR
151 STDRHARRRLREILGPDRSMEGRNRE

>ECFp168611 ECF130 ECF130s1 Streptomyces guanduensis

1 MSADGLPGPRVRRPRAAKLIDPAEPVEFTDFHRANRGAYVRWAALHLGSR
51 AEAEDAVDEAMLELLAKWPAVVARPAPAAYAWTVVKSRTIDAVRASRRRP
101 VAVDIAAFESAALTLATDPIAELETNLALEQAIALLPERQHDVMVLRYRL
151 GYTTRQTARLLDVSEATVRSTVRDARRRLARSLGLDTTEGTCR

>ECFp179082 ECF130 ECF130s1 Streptomyces sparsogenes

1 MTRDHLRPRGVTSMTGLPDELPPDFRAFHQLHRAAYLHRAEVYLGNRSDA
51 EEAVDEAFVQLARSWTRVLAMENPAAYAWKVMKHRAIDVARARKRGPCLV
101 DNATFETAALRDAIDPIAMLEESLNLYQAIKKLPERQQDVVILLHCRGYT
151 VAQTATHLGITEAGVRSTARYARRRLQQLLETTEGNNADDLAH

>ECFp179083 ECF130 ECF130s1 Streptomyces sp. 2133.1

1 MTEKAPGPPSRSLLPKLPADFRAFHQLYRACYVRWAEIHLGSRADAEEAV
51 DRAFEQLAIDWLQVLRQPVPEAYAWKVVKNRTIDIARARGRRPSVVDVAT
101 FETRALHNAVDPIGELEESLSIYQAISQLPERQFDVIVLRYCLGYDTAET
151 ADVMGITVAGVRSTARYARRRLKQVLGLDADERSHDEPIAD

>ECFp179085 ECF130 ECF130s1 Streptomyces melanosporofaciens

1 MTNEFLRSRETTSMTPGLPADFRAFHQLHRKAYIDRAVVYLGNHADAEEA
51 VDAAFEQLLRCWPKVLTMENPAAYAWKVMKNRAVDLARARNRGPALLDNA
101 TFETALLRDAVDPIAVLEESLNLYQAIKRLPERQQDVVILLHCRGYSVAE
151 TATHLGITEAGVRSTARYARRRLQQLLAKEDR

>ECFp179084 ECF130 ECF130s1 Streptomyces melanosporofaciens

1 MTPEESLRRPPGAVALPADFRAFHQLYRAAYVRWAEIHLGSNADAEEAVD
51 HAFEQLALSWQTVLTQPTPEAYAWKVVKNRTIDLARRRNRRPVVADVAAF
101 ETCDLRNAVDPIGELETSLFVYEAINDLPDRQRDVIILRYSLGYDAATTA
151 RILGISPAGVRSTARHARRRLRQVLGLDEQEGIRDGHPTD

>ECFp46655 ECF130 ECF130s1 Streptomyces antioxidans

1 MTTGLPADFRAFHQLHRKAYIDRAMVYLGNHADAEEAVDAAFEQLLRCWA
51 KVLTMENPAAYAWKVMKNRVIDLARARNRGPALLDNATFETAILKDAVDP
101 IAALEESLNLYQAIKKLPERQQDVVILLHCRGYRVAETATHLGITEAGVR
151 STARYARRRLQQLLAKDDR

>ECFp46660 ECF130 ECF130s1 Streptomyces sp. SPMA113

1 MTKGFDFPDSGLTPGMPVDFEAFYEMHRADYIHWAELYLGNRADAEEAVD
51 RAFEQLALDWPEVLVQEKPAAYAWVVMKHRTIDVARERGRRLELIDTAPF
101 ETVELHDAVDPIGELEESLKIYRAISALPERQHDVIVLRYCLGHTITETA
151 DILGITEAGVRSTARYAKRRLKEALGMEKEGSADDHTH

Name Aliases LCA Taxa Group Subgroup
ECFp46661
  • RNA polymerase subunit sigma-24
  • STRIP9103_RS38530
Streptomyces ipomoeae 91-03 ECF130 ECF130s1

>ECFp46661 ECF130 ECF130s1 Streptomyces ipomoeae 91-03

1 MTELPLDFEAFHRMHRPAYVSWAKTYLNNKADAEEAVDRAFEQLLLAWPE
51 ILTKESPAAYAWQVMKNRTIDVARARGRREVLVDTAAFETTALREAVDPM
101 GQLEESINLFQAIEALPERQRDVVVLLYSHGHSVREAADHLGITPAAVRS
151 TARYARRRLQEILGLTKEGQADDVAH

Name Aliases LCA Taxa Group Subgroup
ECFp46652
  • RNA polymerase subunit sigma-24
  • AC230_11815
Streptomyces caatingaensis ECF130 ECF130s1

>ECFp46652 ECF130 ECF130s1 Streptomyces caatingaensis

1 MTGLPADYRAFHQLYRAAYVHWAELYLGNRHDAEEAVDQAFEDLYFTWSE
51 VLGTENPNAYAWAVVRHRTIDCARARGRRPAVIDTAAFETVALRQAADPI
101 GELELSMSIYEAICALPARQHDVIVLHHCLGYSVRETADIMGITEGGVRS
151 TARHARHRLHDALGLEREEEHR

Name Aliases LCA Taxa Group Subgroup
ECFp46650
  • RNA polymerase subunit sigma-24
  • IF55_RS17130
Streptomyces varsoviensis ECF130 ECF130s1

>ECFp46650 ECF130 ECF130s1 Streptomyces varsoviensis

1 MPGLPADFQAFHQLYRGAYVRWAELYLGSRHDAEEAVDHAFEQLCVQWPL
51 VLRQPVAEAYAWKVVKHRTIDFARARGRRPVLVDFAAFETHTLHTAIDPI
101 GALEDSLALYQAIRALPERQRDVVVLRYSLDYSTAETARTLGITEAGVRS
151 TARYARRRLRQELGLLEEGDDDARLEG

Name Aliases LCA Taxa Group Subgroup
ECFp46648
Streptomyces sp. A02 ECF130 ECF130s1

>ECFp46648 ECF130 ECF130s1 Streptomyces sp. A02

1 MTELPADFRAFHQLYRGAYVHWAELYLSNRADAEEAVDQAFEQLFLDWSD
51 VLAKENPNAYAWGIVKHRTIDCARARGKRPVLIDTAAFETAALRDAVDKI
101 GELEEGLHIYAAIRALPERQHDTIVLLYCLGYTVGETADILGVSQAGVRS
151 TARYARHRLREILDTDNRTEREEK

Name Aliases LCA Taxa Group Subgroup
ECFp46659
  • RNA polymerase subunit sigma-24
  • SIRAN_RS37020
Streptomyces iranensis ECF130 ECF130s1

>ECFp46659 ECF130 ECF130s1 Streptomyces iranensis

1 MTNDFPRSREITSMTAGLPADFRAFHQLHRKAYIDRAMVYLGNHADAEEA
51 VDAAFEQLLRCWPKVLTMENPAAYAWKVMKNRVIDLARARNRGPALLDNA
101 TFETAILKDAVDPIAALEESLNLYQAIKKLPERQQDVVILLHCRGYSVAE
151 TATHLGITEAGVRSTARYARRRLQQLLAKDNR

>ECFp46662 ECF130 ECF130s1 Streptomyces violaceusniger

1 MTPGLPADFRAFHQLHRKAYIDRAVVYLGNHADAEESVDAAFEQLLRCWP
51 KVLTMENPAAYAWKVMKNRAVDLARARNRGPALLDNATFETALLRDAVDP
101 IAVLEESLNLYQAIKKLPERQQDVVILLHCRGYSVAETATHLGITEAGVR
151 STARYARRRLQQLLAKEDR

>ECFp46658 ECF130 ECF130s1 Streptomyces sp. NRRL B-1568

1 MKELPPDFRAFHQMYRGAYVHWAELYLENRADAEEAVDHAFEQLYFAWSD
51 VLEHENPNAYAWAVVKNRTIDHARARGRRPTVTDTAAFETDALRCAVDPI
101 AELEESLSLYAAIQALPERQHDVFVLHYCLGYTVRETADLLGITPAGVRS
151 IARFARHRLNEALSTGREERSEC

>ECFp79732 ECF130 ECF130s1 Streptomyces sp. NRRL F-5755

1 MGLPVDFRAFHQLYRAGYIRYAELHLESRADAEEAVDLAFEQLMLAWQTV
51 LRQPVPEAYAWRVVKNRTIDHARARGRRPVVVDVAAFETLSLRHALDPIS
101 ELEESLTLYQTLASLPERQRDVMLLRYALGYATKETARLMGITEAGVRST
151 IRYALRRLRQAFGLEEGEDDARLAD

>ECFp80297 ECF130 ECF130s1 Streptomyces sp. MBT76

1 MQPRLPADFRAFHELYRSRYVYWAQLYLSSWADAEEAVDIAFEQLYFNWS
51 KVLSKANPRAYAWRVVRHRTIDLARARGRRAVAVDTAAFETTRLEQACDP
101 IGELEISLEIYQAVQDLPERQHDVFILHHVLGYTVRETADVLGITEGGVR
151 STARYARHRLNKALGADRYPGRDDQAEGGRG

>ECFp81183 ECF130 ECF130s1 Streptomyces sp. DSM 15324

1 MRPAGNPRAPEKLPLDFSAFHQLHRPRYIREAERCLRCRADAEEAVDEAF
51 VQLAREWPQILRAENPAAYAWRVMKNRVVDHARARGRRATLMDTAVFETV
101 TLQGAEDAFEVIEQNLRLFHAISALPERQQDVIRLRYCEGYETAEVAHEL
151 GITEAGVRSIERYARHRLREIYTSCAEEEAERS

Name Aliases LCA Taxa Group Subgroup
ECFp81785
  • sigma-70, region 4
  • STRIP9103_09166
Streptomyces ipomoeae 91-03 ECF130 ECF130s1

>ECFp81785 ECF130 ECF130s1 Streptomyces ipomoeae 91-03

1 MDFEAFHRMHRPAYVSWAKTYLNNKADAEEAVDRAFEQLLLAWPEILTKE
51 SPAAYAWQVMKNRTIDVARARGRREVLVDTAAFETTALREAVDPMGQLEE
101 SINLFQAIEALPERQRDVVVLLYSHGHSVREAADHLGITPAAVRSTARYA
151 RRRLQEILGLTKEGQADDVAH

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more