ECF proteins of ECF group ECF12

Displaying ECF 161 - 180 of 3228 in total

>ECFp30400 ECF12 ECF12s1 Microbacterium sp. Root553

1 MLATLEREFVDLSGLDWPVMDDTETAEKVSDPRREFEDQAIPFMDQLYAA
51 AMRMTRNPADAADLVQETFVKAYGSWATFSQGTNLKAWLYRILTNTYINI
101 YRKKQREPYQGTIDELEDWQLGGAESTTASHGRSAEAEAIDHMPASVVKD
151 ALQAVPEDFRLAVYLADVEGFAYQEIADIMKTPIGTVMSRLHRGRRMLRE
201 LLADYAAERGISAAEPRSTK

Name Aliases LCA Taxa Group Subgroup
ECFp30404
  • hypothetical protein
  • ASF07_03415
  • ... more
Frigoribacterium ECF12 ECF12s1

>ECFp30404 ECF12 ECF12s1 Frigoribacterium

1 MSTPEGHEPTPTVAAVEPTEADVDAALEAVDADAEKRALFEEQALPFMDQ
51 LYAAGMRMTRNPADASDLVQETFVKAYAAFAQFQQGTNLKAWLYRIQTNT
101 FINTYRKKQRDPYQGTIDELEDWQMGGAESATRASGSTRSAEAEAIDHLP
151 DSAVKDALQKVPEDFRMAVYFADVEGFSYQEIADIMKTPVGTVMSRLHRG
201 RRLLRELLADYARDRGIAVPVGSSKGAKK

Name Aliases LCA Taxa Group Subgroup
ECFp30588
  • RNA polymerase subunit sigma
  • G328_RS0102520
[Zimmermannella] faecalis ATCC 13722 ECF12 ECF12s1

>ECFp30588 ECF12 ECF12s1 [Zimmermannella] faecalis ATCC 13722

1 MNSSDDAPQTGSVQTESDRPLAELFAEQAIPLLDQLYGHAMRMTRNPADA
51 QDLVQETFTKAFQSFASFRQGTNLRAWLYRIQTNLYINTYRKQQRTPYQN
101 SLEELEDWQLGGAESYTGTTSSRSAEAEAIDNLPSTVVKDALAEIPEEFR
151 QAVLLADVQGFAYKEIAEIMDTPTGTVMSRLHRGRKLLRERLRDYAGEYG
201 IGKERDA

Name Aliases LCA Taxa Group Subgroup
ECFp30761
  • RNA polymerase
  • W5W_RS15080
Actinomyces massiliensis 4401292 ECF12 ECF12s1

>ECFp30761 ECF12 ECF12s1 Actinomyces massiliensis 4401292

1 MTDTDEPRPDGAPRANGEAATDLLTDIDPDGSGSLDRAPEDESEEERAAR
51 FEADALPYLDQLYGAAMRMTRNPADAEDLIQDAYARAFASFHQYRPGTNL
101 KAWLYRILTNTFINSYRKKQREPLQSDADAVEDWQLHRAASHDSTGLPSA
151 ENIALDDLPDEEIKAAFSELSEDRRLAVYLADVEGFSYKEIAEIMDTPIG
201 TVMSRLHRGRRQLRELLADHARQLGYTTTREEGR

>ECFp30768 ECF12 ECF12s1 Mycobacterium sp. 1482268.1

1 MPTLAIDGPVHQVHVIDVIGASTEGTVFPRMTEKDGSGPEPVPETTPPTS
51 APVRAEESDAELTARFERDAIPLLDQLYGGALRMTRNPADAEDLLQETMV
101 KAYAGFRSFREGTNLKAWLYRILTNTYINSYRKKQRQPAEYPTEEITDWQ
151 LASNAAHSSTGLRSAEVEALEALPDSEIKEALQALPEDFRMAVYYADVEG
201 FPYKEIAEIMDTPIGTVMSRLHRGRRQLRELLADVAKDRGFIRGQLDAPE
251 EVSS

Name Aliases LCA Taxa Group Subgroup
ECFp30804
  • RNA polymerase sigma factor RpoE
  • A3CU_RS0114710
Amycolatopsis taiwanensis DSM 45107 ECF12 ECF12s1

>ECFp30804 ECF12 ECF12s1 Amycolatopsis taiwanensis DSM 45107

1 MPSTQNSAALESGSTERERVERFERDAMPLLDQLYSAAMRMTRNPADAED
51 LVQETYLKAFGAFSSFREGTNLKAWLYRILTNTYINGYRKRQRQPLQQPT
101 EEITDWQIAQAESHTSSGLRSAEVEAMDRLPDTDVKAALQQLPEEFRLAV
151 YLADVEGFAYKEIAEIMDTPIGTVMSRLHRGRAQLRSLLADVARERGFIR
201 GARQEVAR

Name Aliases LCA Taxa Group Subgroup
ECFp30796
  • RNA polymerase sigma factor RpoE
  • IG99_RS15240
Streptomyces griseus subsp. griseus ECF12 ECF12s1

>ECFp30796 ECF12 ECF12s1 Streptomyces griseus subsp. griseus

1 MGPVTGTDAGTDNGQAELPEGRGDSAESNTERSARFERDALEFLDQMYSA
51 ALRMTRNPADAEDLVQETYAKAYASFHQFREGTNLKAWLYRILTNTFINS
101 YRKKQREPQRSAAEEIEDWQLARAESHMSTGLRSAESQALDHLPDSDVKE
151 ALQAIPEEFRIAVYLADVEGFAYKEIADIMGTPIGTVMSRLHRGRRQLRG
201 MLEDYARERGLVPAGAGESNEVKGSGS

>ECFp30810 ECF12 ECF12s1 Streptomyces puniciscabiei

1 MGPVTGTDAGTDNGQAEQPEGQGVSAEAASESTAARSARFERDALEYLDQ
51 MYSAALRMTRNPADAEDLVQETYAKAYASFHQFREGTNLKAWLYRILTNT
101 FINSYRKKQREPQRSTAEEIEDWQLARAESHMSTGLRSAESQALDHLPDS
151 DVKEALQAIPEEFRIAVYLADVEGFAYKEIADIMGTPIGTVMSRLHRGRR
201 QLRGMLEDYARERGLVPAGAGESNEAKGSGS

>ECFp30819 ECF12 ECF12s1 Mycobacterium avium

1 MVSTATSLLGEEQLAGFLASPGALSVLSGDTAAEGTGFIEMADSPDGPDG
51 VTSPEVPEAHAEPAAHEETREELHEEAREETDAELTARFERDAIPLLDQL
101 YGGALRMTRNPADAEDLLQETMVKAYAGFRSFRAGTNLKAWLYRILTNTY
151 INSYRKKQRQPAEYPTEEITDWQLASNAEHSSTGLRSAEVEALESLPDSE
201 IKDALQALPEEFRMAVYYADVEGFPYKEIAEIMDTPIGTVMSRLHRGRRQ
251 LRGLLADVAKERGFNRGQQTHEEVSS

>ECFp30844 ECF12 ECF12s1 Salinispora pacifica

1 MPVETQARELDDRDTRRRHRVLEGPSWPAVAPADRVSVGHLGGSESVGGV
51 LHVSSARKHPTRGDARLTTEKTDERRARFERDAMPFVDQLYAAGLRMTRN
101 PADAEDLVQETYLKAYAAFHQFEQGTNLKAWLYRILTNTYINSYRRRQRQ
151 PIQAPTDEITDWQLAEAESHTSSGLRSAETEALDRLPDSDIKQALQQLPE
201 EFRLAVYLTDVEGFSYKEVAEIMGTPIGTVMSRLHRGRRNLRKLLEQYAA
251 ERGFSSASSAKGSTGRGV

>ECFp30868 ECF12 ECF12s1 Streptomyces viridochromogenes

1 MGPVPGTDAGTDNGQAEQPEGQGMSVDTSAETTAERSARFERDALEFLDQ
51 MYSAALRMTRNPADAEDLVQETYAKAYASFHQFREGTNLKAWLYRILTNT
101 FINSYRKKQREPQRSAAEEIEDWQLARAESHMSTGLRSAESQALDHLPDS
151 DVKEALQAIPEEFRIAVYLADVEGFAYKEIADIMGTPIGTVMSRLHRGRR
201 QLRGMLEDYARERGLVPAGAGESNEVKGSGS

Name Aliases LCA Taxa Group Subgroup
ECFp30860
  • RNA polymerase subunit sigma-24
  • sigR
  • ... more
Microlunatus phosphovorus NM-1 ECF12 ECF12s1

>ECFp30860 ECF12 ECF12s1 Microlunatus phosphovorus NM-1

1 MNAVTCERPETPTLAMSDAPVRSYVMILPTSSSPTSAGEHPESTTSASEP
51 HDQPVDLATETAEERHARFEAEALPFIDQLYAAALRMTRNPSDAEDVVQE
101 TFAKAYASFHQFTPGTNLKAWLYRILTNTYINSYRKKQRQPQIADGENVD
151 DWQLARAESHTSSGLKSAETVALEHLPDSDVKEALQQLAPDFRLAVFLAD
201 VEGFSYKEIAEIMGTPIGTVMSRLNRGRNQLRNLLAEYARDRGLTVHEGS
251 RR

>ECFp30900 ECF12 ECF12s1 Mycobacterium lentiflavum

1 MSTATSLLGSSMGEEQLVRLFASPVSLGVVRGDAATEGTVLIEMADLDDG
51 PDTVTGSDPVEPVEETDEELTARFERDAIPLLDQLYGGALRMTRNPADAE
101 DLLQETMVKAYAGFRSFRAGTNLKAWLYRILTNTYINSYRKKQRQPAEYP
151 TEEITDWQLASNAEHSSTGLRSAEVEALEALPDTEIKAALQALPEEFRMA
201 VYYADVEGFPYKEIAEIMDTPIGTVMSRLHRGRRQLRSLLEDVAKERGFI
251 RGQQTHEEVTS

Name Aliases LCA Taxa Group Subgroup
ECFp30882
Streptomyces sp. RV15 ECF12 ECF12s1

>ECFp30882 ECF12 ECF12s1 Streptomyces sp. RV15

1 MGPVPGTDAGTEHGQAEQPEGQGSTSTESTAERTARFERDALEFLDQMYS
51 AALRMTRNPADAEDLVQETYAKAYASFHQFREGTNLKAWLYRILTNTFIN
101 SYRKKQREPQRSAAEEIEDWQLARAESHMSTGLRSAESQALDHLPDSDVK
151 EALQAIPEEFRIAVYLADVEGFAYKEIADIMGTPIGTVMSRLHRGRRQLR
201 GMLEDYARERGLVPAGAGESNEAKGSGS

>ECFp30936 ECF12 ECF12s1 Arthrobacter

1 MNNKSVDENLPDVATESEAQRRERFERDAMEYVDQLYSAALRMARNPTDA
51 EDLVQEAYTKAYSAFHQYKPGTNLKAWLYRILTNTYINLYRKRQREPLRT
101 STDTVEDWQMASAMEHSPTGLRSAEVEALDHLPDSDVKAALQAIGEDFRM
151 AVYFVDVEGFSYKEASDILGVPIGTVMSRLHRGRKNLRELLADYAADRGI
201 ATGARNKSAAKADGGAK

>ECFp30962 ECF12 ECF12s1 Cellulosimicrobium funkei NBRC 104118

1 MTALLQTPAPAARVASPTPGSPAPDAAFAAAWSVPGRARDASSNTQTNGG
51 LGSLLMTERISGSDVSGSPATTSGTTPDDGAPAGTTLPADATDAEDTNRA
101 PEAESDAARAARFERDALQYLDQLYSAALRMTRNPSDAEDLVQETFAKAF
151 AAFHQYRPGTNLKAWLYRILTNTFINTYRKKQREPQQAQTDDVEDWQIAR
201 AASHTSQGLRSAEAEALDRLPDSDVKRALQELPEDRRMVVYYADVEGFPY
251 KEIAEIMGTPIGTVMSRLHRGRRQLRELLADYAARRGLVGAKSPGGES

Name Aliases LCA Taxa Group Subgroup
ECFp30994
  • RNA polymerase sigma factor RpoE
  • SCATT_40710
Streptomyces cattleya NRRL 8057 = DSM 46488 ECF12 ECF12s1

>ECFp30994 ECF12 ECF12s1 Streptomyces cattleya NRRL 8057 = DSM 46488

1 MVSVMSTARTEAGYLTWPEWPAAGPSPAAAHRGGSGGGVSSEIFSESGGG
51 AHGLATLAEEVGPVTGTDDGTTEEQPRPRLDAESPEERSARFERDALTFL
101 DQMYSAALRMTRNPSDAEDLVQETYAKAYGSFHQFREGTNLKAWLYRILT
151 NTFINSYRKKQREPQRSGTEEIEDWQLARAESHMSTGLRSAESQALDHLP
201 DSDVKSALQAIPEEFRIAVYLADVEGFAYKEIADIMGTPIGTVMSRLHRG
251 RRQLRGLLEDYARERGLVPAGASAGTGESHDRKGSDQ

Name Aliases LCA Taxa Group Subgroup
ECFp31024
  • RNA polymerase sigma factor RpoE
  • MYCSM_RS06840
Mycobacterium sp. JS623 ECF12 ECF12s1

>ECFp31024 ECF12 ECF12s1 Mycobacterium sp. JS623

1 MVPAICLDRPVDVPGLFGGAATEGTVFPAMTDIDGSAPDSAPETSAPDKP
51 EETDAELTARFERDAIPLLDQLYGGALRMTRNPADAEDLLQETMVKAYAG
101 FRSFREGTNLKAWLYRILTNTYINSYRKKQRQPAEYPTEEITDWQLAANA
151 EHSSTGLRSAEVEALEALPDSEIKDALQALPEEFRMAVYYADVEGFPYKE
201 IAEIMDTPIGTVMSRLHRGRRQLRELLADVARDRGFIRGPQLDAPEEVSS

Name Aliases LCA Taxa Group Subgroup
ECFp31094
  • RNA polymerase
  • O145_RS06410
Actinomyces israelii DSM 43320 ECF12 ECF12s1

>ECFp31094 ECF12 ECF12s1 Actinomyces israelii DSM 43320

1 MTDTDDSRPDGAPREDGDAATDLLTDIDPDGSGDLDRAPEDESEEERAAR
51 FEADALPYLDQLYGAAMRMTRNPADAEDLVQDAYARAFASFRQYRPGTNL
101 KAWLYRILTNTFINSYRKRQREPLQSDADAVEDWQLHRAASHDSTGLPSA
151 ENIALDELPDEEIKAALSELSEDRRLAVYLADVEGFSYKEIAEIMDTPIG
201 TVMSRLHRGRRQLRELLADHARQLGYTTTREGR

>ECFp31090 ECF12 ECF12s1 Mycobacterium gordonae

1 MSTATSLLGAERLDRFLASPAAWFARSGDAATEGTELIKMADIDGETGLD
51 GAALAEETDAELTARFERDAIPLLDQLYGGALRMTRNPADAEDLLQETMV
101 KAYAGFRSFREGTNLKAWLYRILTNTYINSYRKKQRQPSEYPTDEITDWQ
151 LAANAEHTSTGLRSAEVEALESLPDTEIKEALQALPEEFRMAVYYADVEG
201 FPYKEIAEIMGTPIGTVMSRLHRGRRQLRELLADVAKDRGFTRGEQAHEE
251 VSS

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more