ECF proteins of ECF group ECF12

Displaying ECF 141 - 160 of 3228 in total

>ECFp178890 ECF12 ECF12s1 Rhodococcus corynebacterioides NBRC 14404

1 MTDDQPGSTTGAVDPAVLETEDGIRSRASAEDLTARFERDALPLVDQLYG
51 AALRMTRNPSDAEDLVQETYIKAYTAFKSFREGTNLKAWLYRILTNTYIN
101 SYRKKQRQPAQYPTDEITDWQLAATAEHSSTGLRSAEVEALDTLPDDDIK
151 AALAALPEEFRMAVYYADVEGFPYKEIAEIMGTPIGTVMSRLHRGRKQLR
201 HELAEVARERGFLRTTASEEAVR

Name Aliases LCA Taxa Group Subgroup
ECFp30117
  • RNA polymerase subunit sigma-70
  • AUT26_13000
  • ... more
Arthrobacter sp. ATCC 21022 ECF12 ECF12s1

>ECFp30117 ECF12 ECF12s1 Arthrobacter sp. ATCC 21022

1 MTLVRDRTDLPGPTSPAQLDSLQLTVDLASMSTIEPAAAATDQAAGDDAQ
51 APAAVDPSTETAEQRRARFERDAMQYVDQLYSAAMRMARNPSDAEDLVQE
101 AYTKAFSAFHQYKPGTNLKAWLYRILTNTYINLYRKRQREPLQSNSDTIE
151 DWQLAKAESHTSAGLRSAEAEALDHLPDSDVKNALQSIPEEFRLAVYFAD
201 VEGYAYKQISEIMNTPIGTVMSRLHRGRKMLRDMLADYAAERGFRAQTED
251 QATAGSNNQEKEK

Name Aliases LCA Taxa Group Subgroup
ECFp30102
  • RNA polymerase subunit sigma-24
  • RNA polymerase, sigma-24 subunit, ECF subfamily
  • ... more
Cellulomonas fimi ATCC 484 ECF12 ECF12s1

>ECFp30102 ECF12 ECF12s1 Cellulomonas fimi ATCC 484

1 MTSAVQERTAPALDDAVAGAAPGVVPGVVIGWPGTSADAPAGGTPVGGLG
51 SWSMSEDTHRAPDAEDEGARTERFEAEALVYLDQLYGAALRMTRNPADAE
101 DLVQETFTKAFAAFHQYRPGTNLKAWLYRILTNTYINSYRKKQREPQQSR
151 SEEIEDWQLARAESHTSSGLRSAEAEALDHLPDSDVKDALQRIPEEFRIA
201 VYLADVEGFAYKEIAEIMGTPIGTVMSRLHRGRGQLREMLTDYARERGLV
251 AATPGTAEGAR

>ECFp30137 ECF12 ECF12s1 Mycobacterium

1 MSAATSLLDRPMGADQLACFPASPVALSAPSGDTAAEGTGVIDMADTDGA
51 TAREIPDPAPPETDAELLARFERDAIPLLDQLYGGALRMTRNPADAEDLL
101 QETMVKAYAGFRSFRAGTNLKAWLYRILTNTYINSYRKRQRQPAEYPTEE
151 ITDWQLASNAEHSSTGLRSAEVEALEALPDTEIKEALQALPEEFRMAVYY
201 ADVEGFPYKEIAEIMDTPIGTVMSRLHRGRRQLRGLLADVAKERGFNRGH
251 QAHEEVSS

Name Aliases LCA Taxa Group Subgroup
ECFp30163
  • hypothetical protein
  • ASF23_14920
  • ... more
Curtobacterium sp. Leaf261 ECF12 ECF12s1

>ECFp30163 ECF12 ECF12s1 Curtobacterium sp. Leaf261

1 MADETTVDAAELRRLFEAQALPFMDQLYGAAMRMTRNPADASDLVQETFV
51 KAFAAFRQFRQGTNLKAWLYRILTNTFINTYRKNQRNPYQGTIDELEDWQ
101 LGGAESVTQSVSSRSAEADAIDHLPSSAVKDALQAIPEDFRMAVYFADVE
151 GFSYQEIADIMKTPVGTVMSRLHRGRRLLRGLLADHARETGVVPDAASTE
201 TMRPSSRTRKVPATTGRMTGRSGR

>ECFp30166 ECF12 ECF12s1 Arthrobacter sp. Soil762

1 MQTLESDSPEYGSPRSKAVTVDLNAMSTLDPALEAMYEASEREAKTSSDA
51 NPGSDAPAGSDAQPAGDVPVPAETVPAAPAPAEQPVDVATESAEERRVRF
101 ERDAMQYVDQLYSAAMRMARNPADAEDLVQEAYTKAFSAFHQYKPGTNLK
151 AWLYRILTNTYINLYRKRQREPLQSNSDTIEDWQLARAESHTSRGLRSAE
201 AEALDHLPDSDVKRALQAIPEEFRLAVYFADVEGFAYKEISDIMNTPIGT
251 VMSRLHRGRKMLRDMLADYAAERGFKGAVESQDTAATTKQENRK

Name Aliases LCA Taxa Group Subgroup
ECFp30172
  • RNA polymerase sigma factor RpoE
  • TY31_RS20725
Mycobacterium kyorinense ECF12 ECF12s1

>ECFp30172 ECF12 ECF12s1 Mycobacterium kyorinense

1 MCQMERPVLVPGLSGDAPTEGTVLTKMADSDAAIGPEVPAPDPMEEADEQ
51 LTARFERDAIPLLDQLYGGALRMTRNPADAEDLLQETMVKAYAGFRSFTP
101 GTNLKAWLYRILTNTYINNYRKKQRQPAQYPTDEITDWQLAATAEHSSTG
151 LRSAEVEALESLPDTEIKEALQALPEDFRMAVYYADVEGFPYKEIAEIMD
201 TPIGTVMSRLHRGRRQLRGLLADVAKERGFLRGDQAPEEVSS

>ECFp30190 ECF12 ECF12s1 Streptomyces

1 MGPVTGTDAGAEDGRAEDSRTAETAEERNARFERDALQFLDQMYSAALRM
51 TRNPADAEDLVQETYAKAYGSFHQFREGTNLKAWLYRILTNTFINSYRKK
101 QREPQRSAAEEIEDWQLARAESHMSTGLRSAESQALDRLPDSDVKSALQA
151 IPEEFRIAVYLADVEGFAYKEIADIMGTPIGTVMSRLHRGRRQLRGLLED
201 YARERGLVPAGAGAAPGESHDSKGSGS

>ECFp30214 ECF12 ECF12s1 Microbispora sp. GMKU363

1 MTTADDVSIEKQRHRFERDALPYLDQIYAGALRLTRNPADAEDLVQEVFA
51 RAFSNFHQFREGTNLRAWLYRILTNTYINTYRKQQRQPQRTAGEDIEDWQ
101 LAEAASHTSGGLKSAEAEALDGLPDSRVKQALHEVPEDFRLAVYLADVEG
151 FSYKEIAEITGVPIGTVMSRLHRGRRQLRHKLEDYAVELGMIQANGPPGG

>ECFp30211 ECF12 ECF12s1 Amycolatopsis regifaucium

1 MPSTENPAPETGTDAEEAAVRAERFERDAMPLLDQLYSAAMRMTRNPADA
51 EDLVQETYLKAYAAFASFKAGTNLKAWMYRILTNTYINGYRKRQRQPVQQ
101 PTEEITDWQIAKAESHTSSGLRSAEVEAMDNLPDIDVKEALQKLPEEFRL
151 AVYLADVEGFAYKEIAEIMDTPIGTVMSRLHRGRAQLRDLLADVARERGF
201 IRAGKQQEVAGR

>ECFp30230 ECF12 ECF12s1 Sanguibacter sp. Leaf3

1 MMTEDTHRAPEAEGDAERTRRFERDALAHLDQLYSAALRMTRNPSDAEDL
51 VQETFAKAFAAFHQYRPDTNLKAWLYRILTNTFINTYRKKQREPQQSAAE
101 DVEDWQIARAASHTSTGLRSAEAEALDRLPDSDVKRALQEIPEDRRIAVY
151 LADVEGFPYKEIAEIMGTPIGTVMSRLHRGRGQLRALLTDYAADRGFAGA
201 DRTAGTTSTKGER

Name Aliases LCA Taxa Group Subgroup
ECFp30233
  • RNA polymerase subunit sigma
  • BN344_RS09600
Candidatus Blastococcus massiliensis AP3 ECF12 ECF12s1

>ECFp30233 ECF12 ECF12s1 Candidatus Blastococcus massiliensis AP3

1 MDVPDAREGGSRTEVAETRAERDARFERDALPFLDQLYPAALRMTRNPAD
51 AEDLVQETFVKAYSAFHQFAEGTNLKAWLYRILTNTYINSYRKKQRQPQQ
101 YPTDQVQDWQLYAAEEHTSSGLRSAEIEALDHLPDSDIKEALQQLPEDFR
151 LAVYLADVEGFAYKEIAEIMGTPIGTVMSRLHRGRRGLQKLLADYARERG
201 FVRAGAGEEASS

>ECFp30252 ECF12 ECF12s1 Actinomadura kijaniata NBRC 14229

1 MGQVPGTTETVEQRQERFQRDVLPFLDQLYSAALRMTRNPADAEDLVQET
51 FAKAFGSFHQFKEGTNLKAWLYRILTNTFINSYRKKQRQPQQAATEEIED
101 WQLARAESHTSSGLKSAEAEALEHLPDSDVKRALADLPEEFRIAVYLADV
151 EGFAYKEIAEIMGTPIGTVMSRLHRGRRQLRGMLEDYARERGLTGAREGS
201 A

>ECFp30248 ECF12 ECF12s1 Streptomyces toyocaensis

1 MGPVPGTDAGTEHGQAEQPEGQGSTGAESTAERSARFERDALEFLDQMYS
51 AALRMTRNPADAEDLVQETYAKAYASFHQFREGTNLKAWLYRILTNTFIN
101 SYRKKQREPQRSAAEEIEDWQLARAESHMSTGLRSAESQALDHLPDSDVK
151 EALQAIPEEFRIAVYLADVEGFAYKEIADIMGTPIGTVMSRLHRGRRQLR
201 GMLEDYARERGLVPAGAGESNEAKGSGS

>ECFp30286 ECF12 ECF12s1 Micromonospora rifamycinica

1 MPTETRSRERDERGARRLRRLLDGPDWPAVGDGAAAVSTGTPGGTEAADR
51 FVRVSSAGQHPTRGDVRLTTEKTDERRARFERDAMPFVDQLYAAGLRMTR
101 NPADAEDLVQETYLKAYAAFHQFEQGTNLKAWLYRILTNTYINSYRKRQR
151 QPIQAPTEEITDWQLAEAESHTSSGLRSAGTEALDRLPDSDVKDALQQLP
201 EEFRLAVYLTDVEGFSYKEVADIMGTPIGTVMSRLHRGRRNLRKLLERYA
251 AERGFSAAQPAKGSTAAASREV

Name Aliases LCA Taxa Group Subgroup
ECFp30280
  • RNA polymerase sigma factor RpoE
  • TIGR02947 family RNA polymerase sigma-70 factor
  • ... more
Segniliparus rugosus ATCC BAA-974 ECF12 ECF12s1

>ECFp30280 ECF12 ECF12s1 Segniliparus rugosus ATCC BAA-974

1 MPVLCPEQAALDPKPETAAAAVIFDYAPSTMRSLPKGGVRMPVKGPADES
51 PGGSDESQAELTRRFEQEAMPLLDKLYWAAMRMTHNPQDAEDLVQETYIK
101 AFGAFHTFAEGTNLSAWLHRILTNTYINSYRKRQRQPSQYPTDEITDWQL
151 ADVASHDSVGLRSAEVEALDGLPDTEIMKALQSLPEDFRMVVYYADVEGF
201 PYREIAEILEIPIGTVMSRLHRGRKQLRAQLAGLAAEYGIGPESRRARRV
251 NNEVESEEVAS

>ECFp30299 ECF12 ECF12s1 Streptomyces sp. NRRL F-5650

1 MGPVTGTDAGTEHGRSEQPEGRGTGAESAAERSARFERDALEFLDQMYSA
51 ALRMTRNPADAEDLVQETYAKAYASFHQFREGTNLKAWLYRILTNTFINS
101 YRKKQREPQRSAAEEIEDWQLARAESHMSTGLRSAESQALDHLPDSDVKQ
151 ALQAIPEEFRIAVYLADVEGFAYKEIADIMGTPIGTVMSRLHRGRRQLRG
201 MLEDYARDRGLVPAGAGESNEAKGSGS

Name Aliases LCA Taxa Group Subgroup
ECFp30348
Nocardia terpenica ECF12 ECF12s1

>ECFp30348 ECF12 ECF12s1 Nocardia terpenica

1 MRGDTAGDAEHEAVGNPDDVAIDDEFADDEDSGGVRSSASDAELAQRFQR
51 DALPLLDQLYGAALRMTRNPADAEDLVQETFAKAYQGFRSFREGTNLRAW
101 LYRILTNTYINSYRKKQRQPAQYPTDEITDWQLASTAEHTSTGLRSAEME
151 ALEALPDDDIKAALQALPEEFRMAVYYADVEGFPYKEIAEIMGTPIGTVM
201 SRLHRGRKQLKGLLADVAHERGFDRNRAGNGARQEVSQ

Name Aliases LCA Taxa Group Subgroup
ECFp30364
Arthrobacter sp. U41 ECF12 ECF12s1

>ECFp30364 ECF12 ECF12s1 Arthrobacter sp. U41

1 MRDGTVPAVTGTRRSLTVDLKAMSTLDPAVAAMHEVAGNGATPAKSPATG
51 PAGALSDPAPEPGVARASDATDTVQDAAAQETIVDGQALDVTTETTEERR
101 VRFERDAMQYVDQLYSAAMRMARNPADAEDLVQEAYTKAFSAFHQYKPGT
151 NLKAWLYRILTNTYINLYRKRQREPLQSNSDTIEDWQLARAESHTSSGLR
201 SAEAEALDHLPDSDVKRALQDIPEEFRLAVYFADVEGFAYKEISEIMNTP
251 IGTVMSRLHRGRKMLRDMLADYAAERGFRAGPTTAAESNKQENRK

>ECFp30363 ECF12 ECF12s1 Streptomyces acidiscabies

1 MGSTICPNRSSRADLDWTVLHAARTAQIPGAGGAGRRLSSDSGGTGLGAA
51 WNLEEVGPVTGTDAGTEHGQAEQPEGRGVNESTAERSARFERDALEFLDQ
101 MYSAALRMTRNPADAEDLVQEMYAKAYASFHQFREGTNLKAWLYRILTNT
151 FINSYRKKQREPQRSAAEEIEDWQLARAESHMSTGLRSAESQALDHLPDS
201 DVKEALQAIPEEFRIAVYLADVEGFAYKEIADIMGTPIGTVMSRLHRGRR
251 QLRGMLEDYARERGLVPAGAGESNEAKGSGS

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more