ECF proteins of ECF group ECF12

Displaying ECF 101 - 120 of 3228 in total
Name Aliases LCA Taxa Group Subgroup
ECFp30755
  • hypothetical protein
  • IG63_RS0102155
Marmoricola aequoreus ECF12 ECF12s1

>ECFp30755 ECF12 ECF12s1 Marmoricola aequoreus

1 MTSAPDDLEAPVDVETETDAERQLRFERDALPFLDQLYSAGMRMTRNPTD
51 AEDLVQETFAKAYANFHQFRPGTNLKAWLYRILTNTFINTYRKKQRQPQQ
101 SMAEDVEDWQLARAESHSSSGLKSAEMEALERLPSSDVTDALQRLPEDFR
151 LAVYLADVEGFPYKEIAEIMETPIGTVMSRLHRGRRQLRQMLTDYVRDND
201 LLPEATIEAKGGAR

Name Aliases LCA Taxa Group Subgroup
ECFp29897
Agromyces sp. Root81 ECF12 ECF12s1

>ECFp29897 ECF12 ECF12s1 Agromyces sp. Root81

1 MSMGVLERPAVVGVDDLGWPVMTADQIDATPNDAVPADSGAEGSGAEEAA
51 RPLGELFEEQALPFIDQLYAAALRMTKNPADAQDLVQETFVKAFAAFGQF
101 TQGTNLKAWLYRILTNTFINSYRKKQREPYQGTIDDLEDWQLGGAESTTA
151 RSSRSAEAEAIDHLPDSAVKDALQALPEDFRLAVYFADVEGFSYQEIADM
201 MNTPIGTVMSRLHRGRRLLRESLADYAREQGFAAGEKATAPTRRQKMPKS
251 QSMPRSPR

Name Aliases LCA Taxa Group Subgroup
ECFp30742
  • hypothetical protein
  • ON34_RS20695
Nocardia pneumoniae NBRC 100136 ECF12 ECF12s1

>ECFp30742 ECF12 ECF12s1 Nocardia pneumoniae NBRC 100136

1 MPLPVDLAGTAIEGIGVTSDDDVVADDVAAVDDAELAQRFERDALPLLDQ
51 LYGAALRMTRNPADAEDLVQETYVKAYQGFKSFREGTNLRAWLYRILTNT
101 YINSYRKKQRQPAQYPTDEITDWQLAATAEHTSQGLRSAEVEALDALPDD
151 DIKAALQELPEEFRMAVYYADVEGFPYKEIADIMGTPIGTVMSRLHRGRK
201 QLKGLLADVARERGFNRSGERQEVNQ

Name Aliases LCA Taxa Group Subgroup
ECFp29924
Arthrobacter sp. I3 ECF12 ECF12s1

>ECFp29924 ECF12 ECF12s1 Arthrobacter sp. I3

1 MTLVKDRAEPEAGSGQSWTLALPSVPGARRKVTVDLNAMSTMDPAVAAMH
51 EVAGNDATPTKTPDAGTPAALETEVDGKPLDVSTESAEERRVRFERDAMQ
101 YVDQLYSAAMRMARNPSDAEDLVQEAYTKAFSAFHQYKPGTNLKAWLYRI
151 LTNTYINLYRKRQREPLQSNSDTIEDWQLARAESHTSSGLRSAEAEALDH
201 LPDSDVKRALQSIPEEFRLAVYFADVEGFAYKEISDIMNTPIGTVMSRLH
251 RGRKMLRDMLADYAAERGFRAATESSAAADSNKQENRK

>ECFp140383 ECF12 ECF12s1 Arthrobacter enclensis

1 MARVLEETGVAGPVELARLTDGLGGSGTPRPRGLTVDLKAMSTLDPAVSA
51 MYEASRGEAQDSGNVLPRPSGAASNAPAGEAGADLDVSAETMEERRQRFE
101 RDAMQYVDQLYSAAMRMARNPSDAEDLVQEAYTKAFSAFHQYKPGTNLKA
151 WLYRILTNTYINLYRKRQREPLQSNSDTIEDWQLARAESHTSSGLRSAEA
201 EALDHLPDSDVKRALQDIPEEFRLAVYFADVEGFAYKEISDIMNTPIGTV
251 MSRLHRGRKMLRDMLAEYAAERGFKTGAESQAAADSKQQESRK

Name Aliases LCA Taxa Group Subgroup
ECFp29942
Tsukamurella pulmonis ECF12 ECF12s1

>ECFp29942 ECF12 ECF12s1 Tsukamurella pulmonis

1 MSAGSGVAVLERPVAFDGMTDEDITPGAVADSALDEVTETPEQLTARFEA
51 EALPLLDQLYGAALRMTRNPADAEDLVQETYVKAYSAFRSFKKGTNLKAW
101 LYRILTNTYINGYRKKQRQPAQYPTDEITDYQLAATAEHSSTGLRSAEIE
151 ALDALPDDEIKEALAKLPEDFRMAVYYADVEGFPYKEIAEIMGTPIGTVM
201 SRLHRGRRQLRTELEGVARERGFLRGKDSDGAEGAADQEVEQ

>ECFp29949 ECF12 ECF12s1 Pseudarthrobacter siccitolerans

1 MQSLTVDLKAMSTLDPAVSAMYEASQNEAKSSADTRPEPAEPAEDSGQPA
51 DAAEEAVNVSTESADDRRARFERDAMQYVDQLYSAAMRMARNPADAEDLV
101 QEAYTKAFSAFHQYKPGTNLKAWLYRILTNTYINLYRKRQREPLQSNSDT
151 IEDWQLARAESHTSSGLRSAEAEALDHLPDSDVKRALQAIPEEFRLAVYF
201 ADVEGFAYKEISDIMNTPIGTVMSRLHRGRRMLRDMLAEYAAERGFKTAA
251 NAPEAAESTQQENRK

>ECFp29965 ECF12 ECF12s1 Streptomyces sp. TAA486

1 MGPVTGTEDGENAGQETEAERSARFERDALNYLDQMYSAALRMTRNPADA
51 EDLVQEMYAKAYASFHQFREGTNLKAWLYRILTNTFINSYRKKQREPQRS
101 AAEDIEDWQLARAESHMSTGLRSAEAQALDHLPDSDVKEALQAIPEEFRI
151 AVYLADVEGFAYKEIADIMGTPIGTVMSRLHRGRRQLRGMLEDYARDRGL
201 ASAGTGQSHDGKGSGS

Name Aliases LCA Taxa Group Subgroup
ECFp29971
Streptomyces sp. e14 ECF12 ECF12s1

>ECFp29971 ECF12 ECF12s1 Streptomyces sp. e14

1 MGPVPGTDAGTDDGQAELPEGQGTGASASAESTAERSARFERDALEFLDQ
51 MYSAALRMTRNPADAEDLVQETYAKAYASFHQFREGTNLKAWLYRILTNT
101 FINSYRKKQREPQRSAAEEIEDWQLARAESHMSTGLRSAESQALDHLPDS
151 DVKEALQAIPEEFRIAVYLADVEGFAYKEIADIMGTPIGTVMSRLHRGRR
201 QLRGMLEDYARDRGLVPAGAGKSNEAKGSGS

Name Aliases LCA Taxa Group Subgroup
ECFp29986
  • RNA polymerase sigma factor RpoE
  • H343_RS0108865
Streptomyces sp. TAA204 ECF12 ECF12s1

>ECFp29986 ECF12 ECF12s1 Streptomyces sp. TAA204

1 MGPVTGTEDGGDAKQETEAERSERFERDALNYLDQMYSAALRMTRNPADA
51 EDLVQEMYAKAYASFHQFREGTNLKAWLYRILTNTFINSYRKKQREPQRS
101 AAEDIEDWQLARAESHMSTGLRSAEAQALDHLPDSDVKEALQAIPEEFRI
151 AVYLADVEGFAYKEIADIMGTPIGTVMSRLHRGRRQLRGMLEDYARDRGL
201 VPAGAAQSHDGEGSGS

>ECFp30020 ECF12 ECF12s1 Rhodococcus hoagii

1 MLDDHEPANESAGDGPESQDQVIERFERDALPLLDQLYGAALRMTRNPAD
51 AEDLVQETYVKAYSAFRSFKEGTNLKAWLYRILTNTYINSYRKKQRQPAQ
101 YPTDEITDWQLAATAEHSSTGLRSAEVEALDALPDDDIKAALQELPEEFR
151 MAVYYADVEGFPYKEIAEIMGTPIGTVMSRLHRGRKQLRGLLADVARERG
201 FNRGGAVDAAGHSTEVEAEQEVTR

>ECFp30063 ECF12 ECF12s1 Arthrobacter sp. NIO-1057

1 MVIPSVTIRQDTSTVGGTTCMVEDEPRGTRSVSRSRPKSRNSVGDRVDSG
51 VMNNKSVDENLPDVATESEAQRRERFERDAMEYVDQLYSAALRMARNPTD
101 AEDLVQEAYTKAYSAFHQYKPGTNLKAWLYRILTNTYINLYRKRQREPLR
151 TSTDTVEDWQMASAMEHSPTGLRSAEVEALDHLPDSDVKAALQAIGEDFR
201 MAVYFVDVEGFSYKEASDILGVPIGTVMSRLHRGRKNLRELLADYAADRG
251 IATGTRTKSSAKADGGAK

Name Aliases LCA Taxa Group Subgroup
ECFp30053
  • RNA polymerase sigma factor RpoE
  • C892_RS0107765
Nocardiopsis ECF12 ECF12s1

>ECFp30053 ECF12 ECF12s1 Nocardiopsis

1 MSQGQETLDERGARFERDVLPYLDQLYSAALRMTRNPSDAEDLVQETFAK
51 AFGSFHQFKEGTNLKAWLYRILTNTFINSYRKKQREPKQAGTEDVEDWQL
101 AQAASHSSSGLKSAEAEALEHLPDSDVKRALQELPEDFRIAVYLADVEGF
151 AYKEVAEIMDTPIGTVMSRLHRGRRQLRTLLEEYAVDRGFLSGGEPGRES
201 VASGARNDGATREERR

Name Aliases LCA Taxa Group Subgroup
ECFp30082
Streptomyces regalis ECF12 ECF12s1

>ECFp30082 ECF12 ECF12s1 Streptomyces regalis

1 MGPVPGTDAGTDNGQAEQPEGLGTSADMSAETTAERSARFERDALEFLDQ
51 MYSAALRMTRNPADAEDLVQETYAKAYASFHQFREGTNLKAWLYRILTNT
101 FINSYRKKQREPQRSAAEEIEDWQLARAESHMSTGLRSAESQALDHLPDS
151 DVKEALQAIPEEFRIAVYLADVEGFAYKEIADIMGTPIGTVMSRLHRGRR
201 QLRGMLEDYARERGLVPAGAGESNDVKGSGS

>ECFp31000 ECF12 ECF12s1 Curtobacterium sp. ER1/6

1 MESGSGVRAADDLDHGVVHQAVRGERAAVPGPGVAVERGEAAASLLDDRD
51 ERGDVPRLEVRLARDVEDPLGDEHVRPHVAVCPRPPDLPGQRDEGVEAVV
101 LVPLLDAVVAEARVGELGDAGDAQRTVGGVRAEALRRPPALAEGRSADDT
151 EDRSAVDGEGDERRPHGHAPQVVRGPVDRVDDPLPVPLADCVRAGVRRRL
201 LAEEGVVGSLRSEPLAERPLDRLVGVGDVRAVGLRRHVQVGGAEPLEADR
251 VGGVGERAGEVQVGAEVHGGQASGSARLGSARRLGGHDLLLLEPGDRALA
301 GEPRASGGEPVHEDAEQHGDDEPERQDDQRAGERRRREVHEVLRRGEPRG
351 TAPERVERREEAGLERRLEDAARAREVEHHEQHREDRRRPPPEQRVQSDA
401 ERDDHGVVEPGDEEDLPPVRRDDPVERTGDHDADAGDHRGRGGSDDHGPE
451 RTEPGGRGGDRDGRGVAADAQADEQEEQALAGGVLAARGHDVLDRERQVL
501 LVGDRQEHLLGRRRRGLARRGRDVERRTGRAGCVHGGEVAVPHGALGLGR
551 GPDHVGDEPAVRLVGDGLGEHLRGGTLTDDADGELVRGGGVERAEVGERH
601 PDREEERDEDVRPERPERAAEVLRPEDRERPGAVAVITRGVVGVVGVRHA
651 RIVVLCNFGHGEQRYTRRARPVRRVQSVPGSSPPMPVRSARNESRRSTPV
701 GPSSPSCTRSTISQSCAWSSGMPSAGSRTGTACAAKARNTFAGSTCPRPN
751 ERTPGVSMIHPPSRTRRAIDDDEVWRPRPVTAFTTPVARVDPVIALTSVD
801 LPTPEWPTVTVTLPSSTSCRASNGTSSDRLVTIRRSRHAKCARNSVGSAR
851 SVFVMQSTGSSPASNAATRYRSISRVRGSGSAAATTTSIWSAFATITRST
901 SSVSSALRRSSVERSATLTIRAREPGSPDTSPTSETWSPVTTDFLPSSRA
951 FVAVMTRSPAASGPAPSVTRTPKRPRSTFVTQPTGASSWVGRTFVRGRLP
1001 FGFGRMRTFDSYCPYGSSSSVSSPSTSSHQLTVSRPLRAGRHEVRPEVRE
1051 LRQRLRRAADVVDRDAVDDEAHEGPRGRHPVVVVRGPVAAVEASGGDPQA
1101 VVEFLHRASRPVHVRRERGEPVRLVAAQVPDPGDLARSVGQRRQRDQRGG
1151 ELAAAGQVERDTRQGGPTRHPDAAVEHQVVTVTRHGRPPQGQERLEVGAD
1201 LRGRGRPRADADRAARHERGRRERRRVRQVRLDRDVTGGDRTGVHDPLAD
1251 GRLVDADTACTEHLDGHVDVGQARQAVADVREVQALVEARSRQEQAGDEL
1301 RRGRRVDRQPTAPYRAGAGERERHRAVAVVRDVHAEVGEGTDHRTHRTLP
1351 GVRVAVDGDRTGGQRGERREEAHHGPREAAVHRDVAVQRGRRDPEVGAVG
1401 VRLRAVRGCDLLDADAELPQRRDHERGVTGVQGEPDRRGAVGEGGEHELP
1451 VRQRLRAGQGDVAVQRPACAGCDPRIGVVGMRRLGHRFTRVLNAAGGPLA
1501 TATLERTRTALPPVRTTLDGRPGLDSTVMTTDEPQAAPHDLVEETEAQLD
1551 AVSEEADLDGTEPEPADEKTVSEAELRSLFEDQALPFMDQLYGAAMRMTR
1601 NPADASDLVQETFVKAYAAFRQFRQGTNLKAWLYRILTNTFINTYRKNQR
1651 NPYQGTIDELEDWQLGGAESVTQSISARSAEADAIDHLPSSAVKDALQSI
1701 PEDFRMAVYFADVEGFSYQEIADIMKTPVGTVMSRLHRGRRLLRGLLADH
1751 ARETGIVPDAASTATMRGRGRKTPATAGRTDGKDAR

>ECFp178475 ECF12 ECF12s1 Nocardiopsis sp. TSRI0078

1 MDAPAGTSARRPTGLEQGQEQETAEERDERFERDVLPYLDQLYSAALRMT
51 RNPADAEDLVQETFAKAFGSFHQFKQGTNLKAWLYRILTNTFINSYRKKQ
101 REPKQAGSEDVEDWQLAQAASHTAAGLKSAEAEALEHLPDTDVKRALQEL
151 PEDFRIAVYLADVEGFAYKEVAEIMATPIGTVMSRLHRGRRQLRSLLEEY
201 AMERGFLPARAAETAAAASGTSARGRGQDGPDRGDRQ

>ECFp178484 ECF12 ECF12s1 Glycomyces harbinensis

1 MTTTVRGREDERLAALLSGPEWSPSLGGDTTPDMVGGVTAARISGDLART
51 PAVGSEGADERDTVTEAGNESTQERRGRFERDAMPLLDQLYGAALRMTRN
101 PADAEDLVQETYLKAYSKFHQFREGTNLKAWLYRILTNTYINTYRKKKRQ
151 PLTSPTDEITDWQLADAESHSASGLRSAETEALDHLPDSDVKDALQRLGE
201 DFRLTVYLADVEGFSYKEIADIMGTPIGTVMSRLHRGRRQLRQLLSSYAA
251 DRGLSPAREVQQ

>ECFp178482 ECF12 ECF12s1 Streptomyces sp. 2131.1

1 MGSTICPRRSNTADLEWTVLHAAKTTPERSLGGTDRQPAPDQGRLFSDSS
51 GSGFGSAPALEEVGPVTGTDTGTDDGRPQETTAERNARFERDALGFLDQM
101 YSAALRMTRNPADAEDLVQETYAKAYGSFHQFREGTNLKAWMYRILTNTF
151 INSYRKKQREPQRSAAEEIEDWQLARAESHMSTGLRSAESQALDHLPDSD
201 VKSALQAIPEEFRIAVYLADVEGFAYKEIADIMGTPIGTVMSRLHRGRRQ
251 LRGMLEDYARDRGLVPAGAGESDDRKGSGS

>ECFp178501 ECF12 ECF12s1 Rhodococcus marinonascens NBRC 14363

1 MSSVAEPTSRLQLAVILTPTATEGIRVQEHDRPTADRAEPQDQLIARFER
51 DALPLIDQLYGAALRMTRNPADAEDLVQETYVKAYTAFRSFREGTNLKAW
101 LYRILTNTYINSYRKKQRQPAQYPTDEITDWQLAATAEHSARGLRSAEVE
151 ALDALPDDDIKQALQALPEEFRMAVYYADVEGFPYKEIASIMGTPIGTVM
201 SRLHRGRKQLRGLLADVARERGFNRDGADVPAITSSEQEVSQ

>ECFp178495 ECF12 ECF12s1 Streptomyces

1 MGIACPARPAADLPWSQMQVTQPALAGAAAAPDRRLFSESGGSASGSRTV
51 LEEVGPVTGTDAGTDGTAENKAQESAAERNARFERDALTFLDQMYSAALR
101 MTRNPADAEDLVQETYAKAYASFHQFREGTNLKAWLYRILTNTFINSYRK
151 KQREPQRSAAEEIEDWQLARAESHMSTGLRSAESQALDHLPDSDVKAALQ
201 AIPEEFRIAVYLADVEGFAYKEIADIMGTPIGTVMSRLHRGRRQLRGMLE
251 DYARERGLVPAGAATADPQSARTTESHDRKGSGS

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more