ECF proteins of ECF group ECF12

Displaying ECF 81 - 100 of 3228 in total

>ECFp140364 ECF12 ECF12s1 Microbacterium sp. UCD-TDU

1 MTATLEREVIDLSGLDWPVMDDTATADTVGDPRREFEEQAIPFMDQLYAA
51 AMRMTRNPADAADLVQETFVKAYGSWATFSQGTNLKAWLYRILTNTYINI
101 YRKRQREPFQGTIDELEDWQLGGAESTTASHSRSAEAEAIDRMPASVVKD
151 ALQAVPEDFRLAVYLADVEGFAYQEIADIMKTPIGTVMSRLHRGRRMLRE
201 LLADYAAERGIAAAETRSKK

>ECFp140381 ECF12 ECF12s1 Streptomyces

1 MGSTICPRRSNTADLEWTVLRAARTTSQGAAAGADRQPARKQGRLFSDAS
51 GSGSGSATSLEEVGPVTGTDTGTDDGRARETTAERNARFERDALGYLDQM
101 YSAALRMTRNPADAEDLVQETYAKAYGSFHQFREGTNLKAWMYRILTNTF
151 INSYRKKQREPQRSAAEEIEDWQLARAESHMSTGLRSAESQALDHLPDSD
201 VKSALQAIPEEFRIAVYLADVEGFAYKEIADIMGTPIGTVMSRLHRGRRQ
251 LRGMLEDYARERGLVPAGAGESDDRKGSAS

>ECFp140424 ECF12 ECF12s1 Mycobacterium tuberculosis

1 MSTATSLLGEKRLARMLARPVSAPVLSGDTANEGTQLIKMADIDGVTGSA
51 GLQPGASEETDEELTARFERDAIPLLDQLYGGALRMTRNPADAEDLLQET
101 MVKAYAGFRSFRHGTNLKAWLYRILTNTYINSYRKKQRQPAEYPTEQITD
151 WQLASNAEHSSTGLRSAEVEALEALPDTEIKEALQALPEEFRMAVYYADV
201 EGFPYKEIAEIMDNPIGTVMSRLYRGRRQLRGLLADVARDRGFARGEQAH
251 EGVSS

>ECFp140468 ECF12 ECF12s1 Streptomyces harbinensis

1 MGSISCPTRPQRPAAAEVDWATLALAADRSSRPAEGTVRRLSSETGGPVP
51 GFVAFRAEEVGQVTGTDDNVSQDETVRATESEAERNARFERDALGFLDQM
101 YSAALRMTRNPADAEDLVQETYAKAYGSFHQFREGTNLKAWMYRILTNTF
151 INSYRKKQREPQRSAAEDIEDWQLARAESHMSTGLRSAESQALDHLPDSD
201 VKQALQAIPEEFRIAVYLADVEGFAYKEIADIMGTPIGTVMSRLHRGRRQ
251 LRDMLSDYARERGLVPAGTGGAQEGSGS

>ECFp30614 ECF12 ECF12s1 Arthrobacter sp. 135MFCol5.1

1 MAVEALAADPLEYGTPRAGRLTVDLKAMSTLDPAVAAMYEASPGAANGSA
51 PAPPASAAPAGEVGPAAGPDTEDAALDVAAETVEDRRLRFERDAMQYVDQ
101 LYSAAMRMARNPSDAEDLVQEAYTKAFSAFHQYKPGTNLKAWLYRILTNT
151 YINLYRKRQREPLQSNSDTIEDWQLARAESHTSSGLRSAEAEALDHLPDS
201 DVKRALQDIPEEFRLAVYFADVEGYAYKEISDIMNTPIGTVMSRLHRGRR
251 MLRDMLAEYAAERGFKTAADASEAAGSKPQENRK

Name Aliases LCA Taxa Group Subgroup
ECFp30627
  • RNA polymerase sigma factor RpoE
  • U857_RS0103920
Microbacterium ECF12 ECF12s1

>ECFp30627 ECF12 ECF12s1 Microbacterium

1 MPATLEREVIDLSRLDWPVMDDTATAATVGDPRREFEEQALPFMDQLYAA
51 AMRMTRNPADAADLVQETFVKAYGSWSTFAQGTNLKAWLYRILTNTYINI
101 YRKRQREPFQGTIDELEDWQLGGAESTTASHSRSAEAEAIDRMPASVVKD
151 ALQAVPEDFRLAVYLADVEGFAYQEIADIMKTPIGTVMSRLHRGRRMLRE
201 LLADYAAERGIAAADPRSKK

Name Aliases LCA Taxa Group Subgroup
ECFp30624
Streptomyces sp. 769 ECF12 ECF12s1

>ECFp30624 ECF12 ECF12s1 Streptomyces sp. 769

1 MEYVQRARGMGVRRMGIACPARPAADLQWSQMQVTQPALAGAAAAPDRRL
51 FSESRGSAAAVAGSATVLEEVGPVTGTDAGTDGSAAEQPTGRTESDVERN
101 ARFERDALVFLDQMYSAALRMTRNPADAEDLVQETYAKAYASFHQFREGT
151 NLKAWLYRILTNTFINSYRKKQREPQRSAADEIEDWQLARAESHMSTGLR
201 SAESQALDHLPDSDVKAALQAIPEEFRIAVYLADVEGFAYKEIADIMGTP
251 IGTVMSRLHRGRRQLRGMLEDYARERGLVPAGAAAEAQSAPAPESHDRKG
301 TGS

Name Aliases LCA Taxa Group Subgroup
ECFp30612
  • RNA polymerase subunit sigma
  • BS72_RS22485
Streptomyces yeochonensis CN732 ECF12 ECF12s1

>ECFp30612 ECF12 ECF12s1 Streptomyces yeochonensis CN732

1 MGVPPVPKATGDAQESETERSRRFERDALGYLDQMYSAALRMTRNPADAE
51 DLVQETYAKAYASFHQFREGTNLKAWLYRILTNSFINSYRKKQREPLRSG
101 SEEIEDWQLARAESHMSTGLRSAESQALDHLPDSDVKSALQAIPEEFRIA
151 VYLADVEGFAYKEIADIMGTPIGTVMSRLHRGRRQLRELLEDYARDRGLV
201 PAGAAKEKGADS

Name Aliases LCA Taxa Group Subgroup
ECFp30639
Streptomyces sp. 769 ECF12 ECF12s1

>ECFp30639 ECF12 ECF12s1 Streptomyces sp. 769

1 MGPVTGTDAGTDGSAAEQPTGRTESDVERNARFERDALVFLDQMYSAALR
51 MTRNPADAEDLVQETYAKAYASFHQFREGTNLKAWLYRILTNTFINSYRK
101 KQREPQRSAADEIEDWQLARAESHMSTGLRSAESQALDHLPDSDVKAALQ
151 AIPEEFRIAVYLADVEGFAYKEIADIMGTPIGTVMSRLHRGRRQLRGMLE
201 DYARERGLVPAGAAAEAQSAPAPESHDRKGTGS

Name Aliases LCA Taxa Group Subgroup
ECFp30649
  • RNA polymerase sigma factor RpoE
  • IF11_RS0119015
Streptomyces scopuliridis RB72 ECF12 ECF12s1

>ECFp30649 ECF12 ECF12s1 Streptomyces scopuliridis RB72

1 MGPVTGTDGATDDGHIEETIAERNARFERDALGYLDQMYSAALRMTRNPA
51 DAEDLVQETYAKAYGSFHQFREGTNLKAWMYRILTNTFINSYRKKQREPQ
101 RSAAEEIEDWQLARAESHMSTGLRSAESQALDHLPDSDVKAALQAIPEEF
151 RIAVYLADVEGFAYKEIADIMGTPIGTVMSRLHRGRRQLRGMLEDYARDR
201 GLVPAGVGESLDDRKGSDS

Name Aliases LCA Taxa Group Subgroup
ECFp30716
Cellulomonas sp. B6 ECF12 ECF12s1

>ECFp30716 ECF12 ECF12s1 Cellulomonas sp. B6

1 MSCAVATPQAPAPTAAAVGGGVPVVTPWGVPASTGDVQVGALGSWTMSEH
51 PESPAGLDDTGLDDGGTTRAPAGEDDAARSDRFEAEALVHLDQLYGAALR
101 MTRNPADAEDLVQETFTKAFAAFHQYRPGTNLKAWLYRILTNTYINSYRK
151 KQREPQQSRSEEIEDWQLARAESHTSRGLRSAEADALDHLPDSDVKDALQ
201 QIPEDFRIAVYLADVEGFAYKEIAEIMGTPIGTVMSRLHRGRAQLRDLLS
251 DYARERGLTAGGAR

>ECFp30724 ECF12 ECF12s1 Amycolatopsis rifamycinica

1 MPSTQNSAPEEATEAERAERFERDAMPLLDQLYSAAMRMTRNPADAEDLV
51 QETYLKAYAAFASFKAGTNLKAWMYRILTNTYINGYRKRQRQPVQAPTEE
101 ITDWQIAKAESHTSSGLRSAEVEAMDNLPDTDVKAALQKLPEEFRLAVYL
151 ADVEGFAYKEIAEIMDTPIGTVMSRLHRGRAQLRDLLADVARERGFIRSA
201 KEEVAGR

>ECFp30710 ECF12 ECF12s1 Streptomyces mirabilis

1 MGPVPGTDAGTEHGQAEQPEGQGTSTESTPAESTAERSARFERDALEFLD
51 QMYSAALRMTRNPADAEDLVQETYAKAYASFHQFREGTNLKAWLYRILTN
101 TFINSYRKKQREPQRSAAEEIEDWQLARAESHMSTGLRSAESQALDHLPD
151 SDVKEALQAIPEEFRIAVYLADVEGFAYKEIADIMGTPIGTVMSRLHRGR
201 RQLRGMLEDYARDRGLVPAGAGESNEAKGSGS

>ECFp30728 ECF12 ECF12s1 Streptomyces

1 MEEVGPVTGTDAGTEHGQAEQPEGRGTGAESSAERSARFERDALEFLDQM
51 YSAALRMTRNPADAEDLVQETYAKAYASFHQFREGTNLKAWLYRILTNTF
101 INSYRKKQREPQRSAAEEIEDWQLARAESHMSTGLRSAESQALDHLPDSD
151 VKQALQAIPEEFRIAVYLADVEGFAYKEIADIMGTPIGTVMSRLHRGRRQ
201 LRGMLEDYARDRGLVPAGAGESNEAKGSGS

Name Aliases LCA Taxa Group Subgroup
ECFp30712
  • RNA polymerase sigma factor RpoE
  • SLNWT_RS09665
Streptomyces albus ECF12 ECF12s1

>ECFp30712 ECF12 ECF12s1 Streptomyces albus

1 MGAVTGTDAGNDRAESEEQAQQPAETAAERNARFERDALTYLDQMYSAAL
51 RMTRNPADAEDLVQETYAKAYASFHQFREGTNLKAWLYRILTNTFINSYR
101 KKQREPQRSAAEEIEDWQLARAESHMSTGLRSAESQALDHLPDSDVKEAL
151 QSIPEEFRIAVYLADVEGFAYKEIADIMGTPIGTVMSRLHRGRRQLRGML
201 EDYARERGLSTAGASDSDARKGSGS

>ECFp30713 ECF12 ECF12s1 Streptomyces hygroscopicus subsp. hygroscopicus

1 MGQVTGTDAGTDGVTGGEPVERSYETSPERSARFERDALAFLDQMYSAAL
51 RMTRNPADAEDLVQETYAKAYGSFHQFREGTNLKAWLYRILTNTFINSYR
101 KKQREPQRSAAEEIEDWQLARAESHMSTGLRSAESQALDHLPDSDVKEAL
151 QAIPEEFRIAVYLADVEGFAYKEIADIMGTPIGTVMSRLHRGRRQLRGLL
201 EDYARGRGLVPAGASAGADESHDRKGAGS

>ECFp30725 ECF12 ECF12s1 Streptomyces sp. TP-A0874

1 MGQVTGTDAGPERGESAEGRGGREETAAERNARFERDALTFLDQMYSAAL
51 RMTRNPADAEDLVQETYAKAYGSFHQFREGTNLKAWLYRILTNTFINSYR
101 KKQREPQRSGAEEIEDWQLARAESHMSTGLRSAESQALDHLPDSDVKAAL
151 QAIPEEFRIAVYLADVEGFAYKEIADIMGTPIGTVMSRLHRGRRQLRGLL
201 EDYARERGLVPAGVGAASGESHDSKGSRS

Name Aliases LCA Taxa Group Subgroup
ECFp30750
  • RNA polymerase
  • AXE84_08270
  • ... more
Actinomyces ECF12 ECF12s1

>ECFp30750 ECF12 ECF12s1 Actinomyces

1 MMTETMTQTMTKARGVGRAEDSPGALGSWLMTDIDDHTDEITLDEVIDPD
51 DGARDLDRAPADEDEAARAARFEAEALPYLDQLYGAALRMTRNRADAEDL
101 VQDAYAKAFGSFHQYRPGTNLKAWLYRILTNTFINSYRKKQREPLQSDAE
151 TVEDWQLHRAASHDSVGLPSAENLALDALPDSDIKDALGQLTEDRRLAVY
201 LADVEGFSYKEIAEIMDTPIGTVMSRLHRGRRQLRELLADYAREYGYGEE
251 EK

Name Aliases LCA Taxa Group Subgroup
ECFp30738
  • RNA polymerase sigma factor RpoE
  • RNA polymerase subunit sigma
  • ... more
Acidipropionibacterium acidipropionici ECF12 ECF12s1

>ECFp30738 ECF12 ECF12s1 Acidipropionibacterium acidipropionici

1 MYAMTIPSSGAGEAHGRDEAEETDQQRAARFERDAMEYLDQLYGAALRMT
51 RNAADAEDVVQETYAKAFASFKQFRPGTNLKAWLFRILTNTYINTYRKAQ
101 RRPQTSDDENVEDWQIARAASHEATGLRSAEVEALDAMPDTQVVRALDSL
151 SEDFREVVTLADIEGFSYKEIAQIMGTPIGTVMSRLNRARKQLRGQLVDV
201 AGARGIGPKAGKVDEETLGQEVHS

Name Aliases LCA Taxa Group Subgroup
ECFp30744
  • sigH
  • RNA polymerase sigma factor RpoE
  • ... more
Gordonia araii NBRC 100433 ECF12 ECF12s1

>ECFp30744 ECF12 ECF12s1 Gordonia araii NBRC 100433

1 MSCATAHPIAERQIFGSLDLGERPVEFRPARTERTVLSDDEGTDATGDGR
51 IAPGDERAAETDEQRTERFERDALPMLDQLYGAALRMTRNPSDAEDLVQE
101 TFIKAFSAFSSFREGTNLKAWLYRIMTNTYINSYRKKQRQPAQYPTDEIT
151 DWQLAQTAEHSSTGLRSAEIEALDALPDDEIKAALQALPEDFRMAVYYAD
201 VEGLPYKEIAEIMDTPIGTVMSRLHRGRRQLRELLADVARERGFNRGADT
251 HTGVGQ

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more