ECF proteins of ECF group ECF12

Displaying ECF 61 - 80 of 3228 in total

>ECFp31647 ECF12 ECF12s1 Streptomyces bungoensis

1 MGPVTGTDAGTDNGHAEQPEGEGVSAQTGAAASPESTTERSARFERDALE
51 FLDQMYSAALRMTRNPADAEDLVQETYAKAYASFHQFREGTNLKAWLYRI
101 LTNTFINSYRKKQREPQRSAAEEIEDWQLARAESHMSTGLRSAESQALDH
151 LPDSDVKEALQAIPEEFRIAVYLADVEGFAYKEIADIMGTPIGTVMSRLH
201 RGRRQLRGMLEDYARERGLVPAGAGESDEAKGSGS

>ECFp178480 ECF12 ECF12s1 Curtobacterium sp. UNCCL20

1 MATATLARERTGTATVLPAVPTSLGSVPARALPTTLVSPLGLDLAAMTTD
51 EPQAAVPQDLVEETEAQLDAVSEEHEALDDTEANDTEADDTEVDDTEAEA
101 EVDVDVVDAKTVSESELRSLFEDQALPFMDQLYGAAMRMTRNPADASDLV
151 QETFVKAFAAFRQFRQGTNLKAWLYRILTNTFINTYRKNQRNPYQGTIDE
201 LEDWQLGGAESVTQSISARSAEADAIDHLPSSAVKDALQAIPEDFRMAVY
251 FADVEGFSYQEIADIMKTPVGTVMSRLHRGRRLLRGLLADHARETGIVPD
301 AASTATMRGRGRKTAAAQGRVDGKEAR

Name Aliases LCA Taxa Group Subgroup
ECFp29922
  • RNA polymerase sigma factor
  • NONO_c62730
Nocardia nova SH22a ECF12 ECF12s1

>ECFp29922 ECF12 ECF12s1 Nocardia nova SH22a

1 MTVLVDERPVMIGDRPSYAPIDIVTPDTGFGRHPSRAVDSTATATEGTSV
51 TSDDELAADRPRGESAGGSRPEDIEIPDDPVDDEADASSEAADEVGESTV
101 RSTADDTELARRFERDALPLLDQLYGAALRMTRNPADAEDLVQETFAKAY
151 QGFRSFREGTNLRAWLYRILTNTYINSYRKKQRQPAQYPTDEITDWQLAA
201 TAEHTSTGLRSAEMEALEALPDDDIKAALQSLPEEFRMAVYYADVEGFPY
251 KEIADIMGTPIGTVMSRLHRGRKQLKGLLADVAHERGFDRNRTGNGARQE
301 VTQ

>ECFp30184 ECF12 ECF12s1 Arthrobacter sp. 131MFCol6.1

1 MTLVKDRAEPEAGSGQSWTLALPAVPGARRKVTVDLNAMSTMDPAVAAMH
51 EVAGNDATPTKTPDAGASAALETEVDGKPLDVSTESAEERRVRFERDAMQ
101 YVDQLYSAAMRMARNPSDAEDLVQEAYTKAFSAFHQYKPGTNLKAWLYRI
151 LTNTYINLYRKRQREPLQSNSDTIEDWQLARAESHTSSGLRSAEAEALDH
201 LPDSDVKRALQSIPEEFRLAVYFADVEGFAYKEISDIMNTPIGTVMSRLH
251 RGRKMLRDMLADYAAERGFRAATESSAAADSNKQENRK

>ECFp30444 ECF12 ECF12s1 Rhodococcus

1 MLEHDRPKDEQSEVTEPADAVASETPETADELIARFERDALPLLDQLYGA
51 ALRMTRNPSDAEDLVQETYIKAYTAFRSFRDGTNLKAWLYRILTNTYINS
101 YRKKQRQPAQYPTDEITDWQLAATAEHTSTGLRSAEVEALDALPDDDIKA
151 ALQELPEEFRMAVYYADVEGFPYKEIAEIMGTPIGTVMSRLHRGRKQLRG
201 LLGDVAKDRGFNRGEKDVAAEAEGVTR

Name Aliases LCA Taxa Group Subgroup
ECFp30455
  • RNA polymerase sigma-E factor
  • rpoE
  • ... more
Tetrasphaera japonica T1-X7 ECF12 ECF12s1

>ECFp30455 ECF12 ECF12s1 Tetrasphaera japonica T1-X7

1 MSDPVAPDDTVDVATETEQERRERFEREAMPLLDQLYSAALRTTRNPADA
51 EDLVQETYAKAYAAFHQYRPGTNLKAWMYRILTNSYINTYRKRQREPQQS
101 DAADIEDYQLHRAESHQSTGLKSAEAEALDHLPDSEVKRALQELPEEFRM
151 AVYLADVEGFAYKEIAEIMQTPIGTVMSRLHRGRRQLRELLTDYARDRGV
201 RVDAGSEDRR

Name Aliases LCA Taxa Group Subgroup
ECFp30475
  • RNA polymerase sigma factor RpoE
  • IF47_RS0101290
Streptomyces megasporus ECF12 ECF12s1

>ECFp30475 ECF12 ECF12s1 Streptomyces megasporus

1 MGPVTGTDDAAHQKPVETEAERNARFERDALAFLDQMYSAALRMTRNPAD
51 AEDLVQETYAKAYASFHQFREGTNLKAWLYRILTNTFINSYRKKQREPQR
101 SAAEEIEDWQLARAESHMSTGLRSAEAQALDHLPDSDVKEALQAIPEEFR
151 IAVYLADVEGFAYKEIADIMGTPIGTVMSRLHRGRRQLRDLLEGYARERG
201 LVPAGANGAAAPDESHDRKGSGS

Name Aliases LCA Taxa Group Subgroup
ECFp30485
  • RNA polymerase sigma factor RpoE
  • STRVI_RS06325
Streptomyces violaceusniger ECF12 ECF12s1

>ECFp30485 ECF12 ECF12s1 Streptomyces violaceusniger

1 MGQVTGTDAGTDGVTEGEPVERSQETSSERNARFERDALAFLDQMYSAAL
51 RMTRNPADAEDLVQEMYAKAYGSFHQFREGTNLKAWLYRILTNTFINSYR
101 KKQREPQRSAAEEIEDWQLARAESHMSTGLRSAESQALDHLPDSDVKAAL
151 QAIPEEFRIAVYLADVEGFAYKEIADIMGTPIGTVMSRLHRGRRQLRDLL
201 EDYARGRGLVPAGAAAGADESHDRKGADS

>ECFp30505 ECF12 ECF12s1 Mycobacterium sp. IS-3022

1 MDFPMRPVDVPGLFGGTATEGTVFPTMTDSDGSTRDTAPETGPETSPPQE
51 TDAELTARFERDAIPLLDQLYGGALRMTRNPADAEDLLQETMVKAYAGFR
101 SFREGTNLKAWLYRILTNTYINSYRKKQRQPSEYPTEEITDWQLAANAEH
151 SSTGLRSAEVEALELLPDNEIKEALQALPEDFRMAVYYADVEGFPYKEIA
201 EIMDTPIGTVMSRLHRGRRQLRELLTNVARERGFMRGQQMDTPEEVSS

>ECFp30503 ECF12 ECF12s1 Corynebacterium

1 MSGDQTGTSAIRTDESDEELAQRFERDAMPLLDQLYGAALRMTRNPADAE
51 DLVQETYIKAFQGFRSYKPGTNLKAWLYRILTNAYINNYRKAQRRPAEYA
101 TDDITDSQIAETASHTSIGLRSAEVEALEKLPDEEIRDALMSLKEDYRMV
151 VYYADVEGLPYKEIAEIMGTPIGTVMSRLHRGRKQLRDALHNVAVERGFL
201 KEEKGDSPR

>ECFp30581 ECF12 ECF12s1 Herbidospora mongoliensis

1 MGPVSKTAEETLEQRSERFERDVMPYLDQLYSAALRMTRNPADAEDLLQE
51 TFAKAFASFHQFQVGTNLKAWLYRILTNTFINSYRKKQREPKQAGTEEIE
101 DWQLARAESHTSSGLKSAELEALEHLPDSDVKDALAALPEDFRIAVYLAD
151 VEGFPYKEIADIMGTPIGTVMSRLHRGRRQLRSQLEDYARERGLVRSEEG
201 A

>ECFp30562 ECF12 ECF12s1 Micromonospora sp. NRRL B-16802

1 MPTETRSLERDERDAKQLKRLLDAPAWPATARPGGVGPGGVRAVSTGTPA
51 GSESAGTSVRVSSAGKHPTRGDVRLTTEKTDERRARFERDAMPFVDQLYA
101 AGLRMTRNPADAEDLVQETYLKAYAAFHQFEQGTNLKAWLYRILTNTYIN
151 SYRKRQRQPIQAPTEEITDWQLAEAESHTSSGLRSAETEALDRLPDSDVK
201 EALQQLPEEFRLAVYLTDVEGFSYKEVADIMGTPIGTVMSRLHRGRRNLR
251 KLLEQYAAERGFSSARSAKGSTAAAAGREV

Name Aliases LCA Taxa Group Subgroup
ECFp30569
  • RNA polymerase subunit sigma-24
  • G401_RS0133055
Hamadaea tsunoensis DSM 44101 ECF12 ECF12s1

>ECFp30569 ECF12 ECF12s1 Hamadaea tsunoensis DSM 44101

1 MPFIDQLYPAALRMTRNPADAEDLVQETYLKAFAAFHQFEEGTNLKAWLY
51 RILTNTFINSYRRKQRQPVQAPTEEITDWQLAEAESHTSSGLKSAETEAL
101 ERLPDSDVKEALQALPEEFRLAVYLADVEGFSYKEIADIMGTPLGTVMSR
151 LHRGRRNLRGMLEHYAAERGIIAAAERSSDHEVTA

>ECFp140220 ECF12 ECF12s1 Microbacterium sp. MRS-1

1 MTATLAPLVPDIADVDWALMEEHAALESPTPETPATDLVPADEVDSAADA
51 RAQFEQQALPFMDQLYAAGMRMTRNPADAADLVQETFVKAFASWSSFTQG
101 TNLKAWLYRILTNTYINTYRKKQREPYQGTIDDLEDWQLGGAESTTATSS
151 RSAEAEAIDHMPASAVKDALQSIPEDFRLAVYLADVEGFAYQEIADIMKT
201 PIGTVMSRLHRGRRMLRDLLADYARERGMDVPVPATSSSGSKK

Name Aliases LCA Taxa Group Subgroup
ECFp140245
  • hypothetical protein
  • AW16_RS0113800
Cellulomonas sp. HZM ECF12 ECF12s1

>ECFp140245 ECF12 ECF12s1 Cellulomonas sp. HZM

1 MGEGTRAPESEGTAARTARFEADALVYLDQLYGAALRMTRNPADAEDLVQ
51 ETFAKAFAAFHQYKPGTNLKAWLYRILTNTYINSYRKKQREPQQSHAEEI
101 EDWQLARAESHSSTGLRSAEAEALDHLPDSDVKDALQRIPEEFRIAVYLA
151 DVEGFAYKEIAEIMGTPIGTVMSRLHRGRGQLRDMLADYARERGLVRAGT
201 PSGASTGDDAGTEDGR

>ECFp140265 ECF12 ECF12s1 Mycobacterium tuberculosis

1 MTTAVADQQRSASTATPRGDARAPARVGRPRGPISSVGYDAAGPPRAKGA
51 TAEGVGQVPGTTETVEQRQERFQRDVLPFLDQLYSAALRMTRNPADAEDL
101 VQETFAKAFASFHQFKEGTNLKAWLYRILTNTFINSYRKKQRQPQQAATE
151 DIEDWQIHRAESHTSSGLKSAEAEALEHLPDSDVKRALQDLPEEFRMAVY
201 LADVEGFAYKEIAEIMGTPIGTVMSRLHRGRRQLRGMLEDYAEERGLTRA
251 GRGSA

Name Aliases LCA Taxa Group Subgroup
ECFp140268
Xiangella phaseoli ECF12 ECF12s1

>ECFp140268 ECF12 ECF12s1 Xiangella phaseoli

1 MPTEIRNRERDDRDARQLRQLLAGPDWPAAVPPVEVATGTPVGTESPGRS
51 VRVSSAKKHPTRGDVRLTTEKTDERRARFERDAMPFVDQLYAAGLRMTRN
101 PADAEDLVQETYLKAYAAFHQFEQGTNLKAWLYRILTNTYINSYRKRQRQ
151 PIQAPTEEITDWQLAEAESHTSSGLRSAETEALDRLADSDVKDALQQLPE
201 EFRLAVYLTDVEGFSYKEVADIMGTPIGTVMSRLHRGRRNLRKLLEGYAA
251 ERGFSAAQPARSSTAAAGGEV

>ECFp140297 ECF12 ECF12s1 Rhodococcus maanshanensis

1 MSVQCLERPADRSPLDRVAVALIPMASEGISVPDDRPENDQPPQDESGGD
51 LTARFERDALPLLDQLYGAALRMTRNPADAEDLVQETYIKAYSAFRSFKE
101 GTNLKAWMYRILTNTYINSYRKKQRQPAQYPTDEITDWQLAATAEHTSQG
151 LRSAEVEALDTLPDDDIKAALQELPEEFRMAVYYADVEGFPYKEIAEIMG
201 TPIGTVMSRLHRGRKQLRGLLADVARERGFNRSGAAAATAAQEQEATR

>ECFp140334 ECF12 ECF12s1 Micrococcus

1 MSAALLTHASRTVDWPAMSTDNSRPEFARPEDAPEHDRADIDVAAESEQQ
51 RRARFERDALEFVDQLYSAALRMTRNPQDAEDLVQEAYTKAYSSFHQYRP
101 GTNLKAWLYRILTNTYINLYRKRQRQPLEADNPEVEDWQMARAAEHTSGG
151 LRSAETEALDRLPDSQVKDALQAIPEEFRLAVYFADVEGFAYKEIAEILD
201 VPIGTVMSRLHRGRKQLRERLADYAAARGIKAQPKKKTGRGGTKQTETST
251 KEATR

Name Aliases LCA Taxa Group Subgroup
ECFp140344
Micromonospora citrea ECF12 ECF12s1

>ECFp140344 ECF12 ECF12s1 Micromonospora citrea

1 MPIETQARERDERGTRQLRQLLDAPDWPATVPPVGATAVSASTPAGSESA
51 GRPVRVSSAGKHPTRGDVRLTTEKTDERRARFERDAMPFVDQLYAAGLRM
101 TRNPADAEDLVQETYLKAYAAFHQFEQGTNLKAWLYRILTNTYINTYRKR
151 QRQPIQAPTEEITDWQLAEAESHTSSGLRSAETEALDRLPDSDVKEALQQ
201 LPEEFRLAVYLTDVEGFSYKEVADIMGTPIGTVMSRLHRGRRNLRKLLEQ
251 YAAERGFSAASSKKGSTAAAGREV

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more