ECF proteins of ECF group ECF12

Displaying ECF 41 - 60 of 3228 in total

>ECFp114699 ECF12 ECF12s10 Mycobacterium asiaticum

1 MDPACPTMDSDLIARFERDALPLLDDLYSAARRLTRDRADAEDLVQETML
51 KAYSQFHSFNGSSQVGTWLYRILQNTWINNYRKSRRRPAEQLTAEITQWQ
101 HEASEGRSPEIDVLEKVPDSKVIQALEALPKSFRMAVYYADVQGYRYREI
151 AEILDIPIGTVMSQLYTARRKLRELLVDVAREYGFE

Name Aliases LCA Taxa Group Subgroup
ECFp30425
  • RNA polymerase sigma factor RpoE
  • HGBR_RS02875
Brevibacterium senegalense ECF12 ECF12s10

>ECFp30425 ECF12 ECF12s10 Brevibacterium senegalense

1 MTEIAHPPAAETDDERHERFERDALEYVNQLYGAALRMTRNPADAEDLVQ
51 EAYAKAYAAFHQYTPGTNLKAWLYRILTNTFINNYRKKQRRPQESSGEGI
101 EDWQIHRAASHTSSEGRSAELVALDHLPDSDVTDALSSLPEDRRMVVYYA
151 DVEGMPYKEIADVMGTPIGTVMSRLHRGRRQLRELLADYARDRGFGLEKR
201 EEA

Name Aliases LCA Taxa Group Subgroup
ECFp140416
Streptomyces rubidus ECF12 ECF12s10

>ECFp140416 ECF12 ECF12s10 Streptomyces rubidus

1 MNAVDTGERAGRRNLRYVEDRDEHFEAATDLLGPMYSAALRLTRNAPDAE
51 DLVQDTYAKAYVSFHQFEQGTNLRAWLYRILTNTYFSAYRKKQREPRCSA
101 MDGIQDWQLARAASHTSGGGCSAESQALDRMPDPAVKAALQALPEEYRIP
151 VYLADVEGFTYREIAEIMGTPMGTATSRLHRGRRRLRRTLQATHAAAGPP
201 RPM

Name Aliases LCA Taxa Group Subgroup
ECFp146991
  • RNA polymerase sigma factor RpoE
  • N420_RS0119745
Mycolicibacterium iranicum UM_TJL ECF12 ECF12s10

>ECFp146991 ECF12 ECF12s10 Mycolicibacterium iranicum UM_TJL

1 MISVGSAQLQDTTGHLGAVSDETEAELAARFVRDVTPLLNTLLGGAVRIT
51 AQRADAEDLVQETMVLAYKNFRTFQQGTNLKGWLFRIQANAHISGYRRRI
101 RRPAELPVPINFDWQLPPDARRSPRLLRSAEAQVLEWLPDDGVRNALAAL
151 SVEFRMTVYYADVAGLTYKEISEIMCIPIGTVMSRIHRGRSRLRNLLADL
201 ATDRGYAREQEAG

>ECFp147195 ECF12 ECF12s10 Mycobacterium sp. UM_CSW

1 MGSCNSGATTLDIRFQREVLPFSDKLFTSALRLTRSTQDAEDLVQETMLR
51 AYAGFRSFQDGSNLNAWLYRIMHNTVINLHRKRKCRPAELLTDDFVDRQL
101 ANNVLRAPTAEGSAEAAALASLPDAEIKAALTALREDCRMTVYYSDVEGF
151 SNKEIASMMNCSVGTVVSRLHRGRKRLRVALLGVAQQRGLCKAA

>ECFp163820 ECF12 ECF12s10 Mycobacterium sp. SWH-M5

1 MTIRPGPRHGGTMAITVGHPADDDSPLTSRDATLTARFVDDALPHLDQLH
51 DRARRMTRNVADAEDLVQETMLKAYAGFHTFSEGTNIQAWLFRIMTNTYI
101 SGLRRAEHRPVEYLSDHITDQQLAAHDRHSLQGPRSAELDALDVLPGKEL
151 TDALATLPVQFRLAVYYRDVIGLRSREIAEIMACCEGTVLSRLYRARHRL
201 RTLLHAADERS

>ECFp168879 ECF12 ECF12s10 Mycolicibacterium diernhoferi

1 MSMPDRRDDTDDELGSRFETEVIPLLDGLFAAAMRMTLQRADAEDLVQET
51 MIKAYAGFRSYQPGTNLMGWLLRIQTNAHISAYRKRIRRPAETLTSSLPD
101 RQLAADAERSPRALRSAELIVLESLPDNDIKAALDALPEVFRMAVYYADV
151 ENLPHKEICEIMGTPPGTVMSRIHRGRARLRVLLAELAAERGYLLASSTS
201 GAETTVRHRRRNLAPALT

>ECFp30869 ECF12 ECF12s10 Streptomyces xylophagus

1 MTTTRSLSGATVHEPQDSTRSEADLQARFEPALTYLDRLYSAALRMTCHQ
51 ADAEDLVQETYARAYTSFHQFREGTNLKAWLYRILTTTFLNSRRTQRRRP
101 QNDGTAEMEDWQLARAQSHTSTGLRTAEADALDRLLDADVKAALQAIPES
151 FRIVVYLFDVEGFTVREIADIMRTPVGTVLSRLHRGRGQLRSLLEGYARE
201 HRLVPAARCRP

Name Aliases LCA Taxa Group Subgroup
ECFp30915
  • RNA polymerase sigma24 factor
  • Q367_RS06985
Ferrimicrobium acidiphilum DSM 19497 ECF12 ECF12s10

>ECFp30915 ECF12 ECF12s10 Ferrimicrobium acidiphilum DSM 19497

1 MGLSVADKKNFSSDAMQYTENLYSAALRMTHNAADAEDLVQETFLKAYRG
51 YDSFQAGTNLKAWLYRILTNTYINIYRAKKRRPDESNLEDVEDLYLYRRL
101 GGLEAVQAGRSAEEEVLDRITDTDVKAAIDSLPEQFRLAVVLSDIEGFSY
151 KEIAEIMDVPLGTVMSRLHRGRRAMQRALLELELQKAAVSGNLEEGNWS

Name Aliases LCA Taxa Group Subgroup
ECFp31101
  • RNA polymerase sigma factor RpoE
  • MYVA_2205
  • ... more
Mycolicibacterium vaccae ECF12 ECF12s10

>ECFp31101 ECF12 ECF12s10 Mycolicibacterium vaccae

1 MAPTSEDTVLERFERDVLPLLDQLYRAARRHTGSTADAEDLVQETMIRAY
51 RGFHRFEDGTNVRAWLLRIMTNTWITSYRKAQCRPEEVLSEGITDAQLAG
101 QGRHSGTGLPSAELAALEAMGDDEVRDALARLREDQRLVVYYADVEGLRY
151 REIAFILDIPLGTVMSRLHRGRRALRTLLFDVATDRGYLRGARAA

Name Aliases LCA Taxa Group Subgroup
ECFp31386
Streptomyces rubidus ECF12 ECF12s10

>ECFp31386 ECF12 ECF12s10 Streptomyces rubidus

1 MRYVEDRDEHFEAATDLLGPMYSAALRLTRNAPDAEDLVQDTYAKAYVSF
51 HQFEQGTNLRAWLYRILTNTYFSAYRKKQREPRCSAMDGIQDWQLARAAS
101 HTSGGGCSAESQALDRMPDPAVKAALQALPEEYRIPVYLADVEGFTYREI
151 AEIMGTPMGTATSRLHRGRRRLRRTLQATHAAAGPPRPM

Name Aliases LCA Taxa Group Subgroup
ECFp31671
  • sigH
  • RNA polymerase sigma-70 factor
  • ... more
Brevibacterium mcbrellneri ATCC 49030 ECF12 ECF12s10

>ECFp31671 ECF12 ECF12s10 Brevibacterium mcbrellneri ATCC 49030

1 MRNIPSEVTVTATLVDWELMEKNTMSAPSDHDVDLTTETEDERRARFENE
51 ALEYVNQLYAAALRMTRNPADAEDLVQEAYLKAYAAFHQYQPGTNLKAWL
101 YRILTNTFINSYRKKQRQPQETGGDTIEDWQIARAANHTSSEGKSAEIEA
151 LERIPDSDIKEALQSLPDDFRMVVYYADVEGLPYKEISQIMDTPMGTVMS
201 RLHRGRRQLREMLADYAAERGFGEGVGS

>ECFp63057 ECF12 ECF12s10 Mycobacterium sherrisii

1 MTLMSLSPPDPESHTRVDDLAARFERDVIPLLDQLYRAARRCTQSHADAE
51 DLVQETMVKAYVGFASFQDGTNLRAWLYTIMNRTRINHYRTAARRPAEWL
101 ADDVGDYVLGAATQQSARRMSAEAEALESMGDHEIRQALQKLPEAQQLAV
151 YYADVEGLRYKEIGEILDIPLGSVMSRIHRGRRNMRKLLMEFAVENRYIR
201 EHDDVTIAA

Name Aliases LCA Taxa Group Subgroup
ECFp65299
  • RNA polymerase sigma factor RpoE
  • RNA polymerase subunit sigma
  • ... more
Mycobacterium simiae ECF12 ECF12s10

>ECFp65299 ECF12 ECF12s10 Mycobacterium simiae

1 MSLSPPDPESPAPVDDLAARFERDVVPLLDQLYRAARRCTQSHADAEDLV
51 QETMVKAYVGFASFQDGTNLRAWLYTIMNRTRINHYRTAARRPAEWLADD
101 VGDYVLSAAAQQSARRMSAEAEALESMGDYEIRQALQKLPEAQQLAVYYA
151 DVEGLRYKEIGEILDIPLGSVMSRIHRGRRNMRKLLMDFAVENRYIREHD
201 GVTIAA

>ECFp84304 ECF12 ECF12s10 Mycobacterium sp. 852002-51057_SCH5723018

1 MGTGCLDRDAALAMRFERDVGPLLDDLYGAARRLTGNRADAEDLIQDTML
51 KAYSQFHTLREESRLRAWLYRIMHNTWINNHRKSLSRPAEQLSADIDHVQ
101 HRGRFEVCSARWRPAELDVLESLSDRKVIEALEALPESQRMTVYYADVHG
151 YRYREIAEILDIPIGTVMSRLHSARRRLRGLLEEVARDQGLI

>ECFp85633 ECF12 ECF12s10 Mycobacterium sp. 852002-51057_SCH5723018

1 MTLPVESPARLDSTAGFERQVAPALGDLYRQARRLTDQHADAEDLVQETL
51 AKAFAGFDSFRPDSNIHAWLYRILLNTHISHCRKTKRRPTHDLAQHITDV
101 QLMKNAAHSAWGLPSAEEQALKGFGDQDVRAAMRALPEQFRTTVYYADIE
151 GLRCKEIAAVMNAPIGTVVSRLHRGRRRLRLLLAEARRCAGYAASQDLAR
201 TA

Name Aliases LCA Taxa Group Subgroup
ECFp696
  • RNA polymerase sigma factor RpoE
  • RNA polymerase, sigma-24 subunit, ECF subfamily
  • ... more
Mycolicibacterium ECF12 ECF12s10

>ECFp696 ECF12 ECF12s10 Mycolicibacterium

1 MRRSSIQWNQQPDNLFGGPVMDSPPEDTVLQRFERDVLPLLDQLYRAARR
51 YTGSVADAEDLVQETMVKAYGGFHRFEDGTNVRAWLLRIMTNTWIKSYRR
101 AQCRPEEVLSEDITDAQLAGHGRHSSTGLPSAELAALEALGDDEVRDALG
151 RLREDQRLVVYYADVEGLRYKEIALILDIPVGTVMSRLHRGRRALRSLLV
201 DVATARGYLRDAAAA

Name Aliases LCA Taxa Group Subgroup
ECFp63365
  • RNA polymerase sigma factor, sigma-70 family
  • Mycsm_03599
  • ... more
Mycobacterium sp. JS623 ECF12 ECF12s10

>ECFp63365 ECF12 ECF12s10 Mycobacterium sp. JS623

1 MGTVAAARTECVSPTGDPAIATSFEREVIPLIESLRRRAVRLTSIPADAE
51 DLLQETLLKAYAGRHSFQQGTNLSAWLFRIMTNTYINGYRSKKRRPAQCL
101 TDQLSDRQLAASAAHLPAALWSAEDQALATLADPRIKAAMQALPEKFRIA
151 VYFADVAGFSYKEIAGIMDTEEGTVSSRISRGRQRLRTLLTDATS

>ECFp140399 ECF12 ECF12s10 Mycobacterium sp. UM_WWY

1 MASGYEVARTGSTTNGRSGAMPVTKPVPMSVRFERDALPLLDQLYGVARK
51 YARSAADAEDLAQETMLKAYASFHTFEEGTNIRAWLFRILTNTWINSYRA
101 AQRRPDEVLADTVTDAQLAAVAARSTVELASAELAALESLGDDEVCQAVQ
151 SLPEFQRIVVYYADVVGFRYKEIAEILDIPVGTVMSRLHRGRRELRGLLA
201 EIAVARGYVGRDGSAGAAA

>ECFp30841 ECF12 ECF12s10 Streptomyces fulvoviolaceus

1 MITARPRFEPALAHLDRLYSAALRMTGSPTDAEDLVQETYARAYTSFHQF
51 REGTNLKAWLYRILTTTFLNSRRSLGRRPQYDSTAELDDRQLARAESHTS
101 TGLRTAESEALDHLPDADVKAALQAIPEGFRIVVYLFDVEGFTVREIADI
151 MRTPVGTVLSRLHRGRGQLRSLLEGYAREHRLVPADRYRRGERKRCGHA

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more