ECF proteins of ECF group ECF12

Displaying ECF 21 - 40 of 3228 in total

>ECFp61884 ECF12 ECF12s9 Mycolicibacterium vulneris

1 MVPCIEQIRGRARRLTANPYDAEDLIQETMLKAYSGFHTFQADSNARAWL
51 FRIMYNNWINTYRARQRGVAEQLCEDFTDWQLSAEARHTSSGLRSAEVEA
101 LETMRDDEIADALSAIPAVNRVTVYLADVEGYPYREIASLMGTPIGTVMS
151 RLARGRRRLRELLNDVAKDRGIIRVPADGPGPLPQSTR

>ECFp61881 ECF12 ECF12s9 Mycobacterium sp. E802

1 VEQIERGARRLTHNRYDAEDLVQETLLKAYSGFHTFKPGSNARAWLFRIM
51 YNNWINSYRARQRAVGEQLCEDITDWQVSAEGRHTSSGLRSAEVEALEAM
101 RDDDIADALDAIPAANRMTVYFADVEGYHYREIAALMGTPVGTVMSRLHR
151 ARRNLRKLLAETAVARGYLARSQDNGTAA

>ECFp62407 ECF12 ECF12s9 Mycolicibacterium porcinum

1 MFYISREVCVRLNSDTEPPAGSQDATRFLDTVVPCIEQIRGRARRLTANP
51 YDAEDLIQETMLKAYSGFHTFQADSNARAWLFRIMYNNWINTYRARQRGV
101 AEQLCEDFTDWQLSAEARHTSSGLRSAEVEALETMRDDEIADALSAIPAV
151 NRVTVYLADVEGYPYREIASLMGTPIGTVMSRLARGRRRLRELLNDVAKD
201 RGIIRVPADGPGPLPQSTR

>ECFp62820 ECF12 ECF12s9 Mycolicibacterium houstonense

1 MRSDRDTDSLTAAHNATLFVNTVLPCIDQIARRAQRLTANRYDAEDLLQE
51 TLLKAYSGFHTFQPGSNARAWLFRIMYNNWVNTYRVRQRGVGEQLCEDFT
101 DWQLSAAAGHMSCGLRSAEVEALETMRDDEIADALGAIPAVNRVTVYLAD
151 VEGYAYREIASLMGTPIGTVMSRLARGRCRLRELLSDVARDRGVGRLPAD
201 GPGPRRRSIP

>ECFp64047 ECF12 ECF12s9 Mycolicibacterium vulneris

1 MNSDTESPAGSQDATRFLDTVVPCIEQIRGRARRLTANPYDAEDLIQETM
51 LKAYSGFHTFQADSNARAWLFRIMYNNWINTYRARQRGVAEQLCEDFTDW
101 QLSAEARHTSSGLRSAEVEALETMRDDEIADALSAIPAVNRVTVYLADVE
151 GYPYREIASLMGTPIGTVMSRLARGRRRLRELLNDVAKDRGIIRVPADGP
201 GPLPQSTR

>ECFp64463 ECF12 ECF12s9 Mycobacterium sp. E802

1 VEQIERGARRLTHNRYDAEDLVQETLLKAYSGFHTFKPGSNARAWLFRIM
51 YNNWINSYRARQRAVGEQLCEDITDWQVSAEGRHTSSGLRSAEVEALEAM
101 RDDDIADALDAIPAANRMTVYFADVEGYRYKEIAELMDIPVGTVMSRLHR
151 ARRNLRKLLAETAVARGYLARSQDNGTAA

>ECFp64508 ECF12 ECF12s9 Mycolicibacterium setense

1 MHLSGGAPSLNNATEPLPDRQDATRFVDTVLPCIEQIRGRARRLTTSRYD
51 ADDLMQETLLKAFSGFHTFEPGSNARAWLFRIMYNNWVNMYRTRQRGVCE
101 QLCEDFTDWQLSAEARHTSLGLRSAEVEALEAMRDDEIADALAAIPAVNR
151 VTVYLADVEGYPYREIASLMGTPVGTVMSRLARGRKRLRELLSDVAKDRG
201 LVRAPAGGPNPRL

Name Aliases LCA Taxa Group Subgroup
ECFp64753
  • hypothetical protein
  • B133_RS0116325
Mycobacterium sp. 155 ECF12 ECF12s9

>ECFp64753 ECF12 ECF12s9 Mycobacterium sp. 155

1 MHPGGDVPNCDVASASRPTFDDAGTAARFAAEALPHLDQIRRGAYRLTAS
51 KYDAEDLVQETLLKAYSGFHTYQPDTNMRAWLFRIMQNTWTSAYYARQRR
101 PNELLCEGLSDWQLLDERIFTPVGLRAAEIEAMTMSYDDEIIRALKAIPL
151 QNRMAVYFADIEGYQYREIAAMMGTPIGTVMSRLARGRSRLRALLSECRR
201 RTQSGETEQPA

>ECFp65139 ECF12 ECF12s9 Mycolicibacterium smegmatis MKD8

1 MRIDNVHSSAASARDATEFIATALPFVEAIERGARRLTTNRYDAEDLVQE
51 TLLKAYNGFHTFEGGTNMQAWLFRIMRNTWISNFRAQQRTPVEQLCEDFT
101 DAQLSAGLRHGADGARSAENEALAHLPDDAVLEALRAIPQANRMVVYYAD
151 VEGYPYREIATLMDTPIGTVMSRLARGRARLRVLLADHQAALPAGRAR

>ECFp65237 ECF12 ECF12s9 Mycobacterium sp. E802

1 VEQIERGARRLTHNRYDAEDLVQETLLKAYSGFHTFADGTNIRAWLFKIL
51 TNTWINSYRTTQRRPEEVLAESVTDAQLAAALAGSPIELASAELAALESM
101 GDDEVRRAMEALPDFQRVIVYYADVACFRYKEIAELMDIPVGTVMSRLHR
151 ARRNLRKLLAETAVARGYLARSQDNGTAA

Name Aliases LCA Taxa Group Subgroup
ECFp65357
  • ECF sigma factor RpoE1
  • MSMEG_0573
  • ... more
Mycolicibacterium smegmatis ECF12 ECF12s9

>ECFp65357 ECF12 ECF12s9 Mycolicibacterium smegmatis

1 MRIDNVHSSAASARDATEFIATALPFVEAIERGARRLTTNRYDAEDLVQE
51 TLLKAYNGFHTFEGGTNMQAWLFRIMRNTWISNFRAQQRNPVEQLCEDFT
101 DAQLSAGLRHGADGARSAENEALAHLPDDAVLEALRAIPQANRMVVYYAD
151 VEGYPYREIATLMDTPIGTVMSRLARGRARLRVLLADHQAALPAGRAR

>ECFp61750 ECF12 ECF12s9 Mycolicibacterium smegmatis MC2 155

1 MPVRIDNVHSSAASARDATEFIATALPFVEAIERGARRLTTNRYDAEDLV
51 QETLLKAYNGFHTFEGGTNMQAWLFRIMRNTWISNFRAQQRNPVEQLCED
101 FTDAQLSAGLRHGADGARSAENEALAHLPDDAVLEALRAIPQANRMVVYY
151 ADVEGYPYREIATLMDTPIGTVMSRLARGRARLRVLLADHQAALPAGRAR

>ECFp144871 ECF12 ECF12s9 Mycolicibacterium peregrinum

1 MTIDVDSPADRHDNNHFVDTVMPCIEQIRRRAQRLTASGYDADDLLQETL
51 LKAYSGFHTFEPGSNARAWLFRIMYNNWVTTYRMRQRGVSKQLCEDFSDW
101 QLSAEARHTSAGLRSAEVEAIEAMRDDEIADALSAIPAVNRVTVYLADVE
151 GYPYREIACLMGTPIGTVMSRLARGRKRLRELLSEVAKDRGLLRTQAAGP
201 IPRPQ

>ECFp30565 ECF12 ECF12s10 Ferrimicrobium acidiphilum DSM 19497

1 MADKKNFSSDAMQYTENLYSAALRMTHNAADAEDLVQETFLKAYRGYDSF
51 QAGTNLKAWLYRILTNTYINIYRAKKRRPDESNLEDVEDLYLYRRLGGLE
101 AVQAGRSAEEEVLDRITDTDVKAAIDSLPEQFRLAVVLSDIEGFSYKEIA
151 EIMDVPLGTVMSRLHRGRRAMQRALLELELQKAAVSGNLEEGNWS

>ECFp63262 ECF12 ECF12s10 Mycobacterium simiae ATCC 25275 = DSM 44165

1 MSLSPPDPESPAPVDDLGARFERDVVPLLDQLYRAARRCTQSHADAEDLV
51 QETMVKAYVGFASFQDGTNLRAWLYTIMNRTRINHYRTAARRPAEWLADD
101 VGDYVLSAAAQQSARRMSAEAEALESMGDYEIRQALQKLPEAQQLAVYYA
151 DVEGLRYKEIGEILDIPLGSVMSRIHRGRRNMRKLLMDFAVENRYIREHD
201 GVTIAA

>ECFp63549 ECF12 ECF12s10 Mycobacterium sp. 1100029.7

1 MTIMLQSPPDPAPGACADDLAARFERDVIPLLDQLHRAARRYTHSHADAE
51 DLVQETIVKAYVGFASFQEGTNLRAWLYTILNRTRINHYRSAARRPAEWL
101 ADDVGDYLTSAAAQHMSRGLMSAEAEALELMGDVEVRQALQKLPESQQLA
151 VYYADVEGFRYKEIGEILDIPLGSVMSRIHRGRRNMRKLLMDFAIENRYI
201 RERDDATIAA

Name Aliases LCA Taxa Group Subgroup
ECFp63759
  • ECF subfamily RNA polymerase sigma-24 factor
  • RNA polymerase subunit sigma
  • ... more
Mycobacterium triplex ECF12 ECF12s10

>ECFp63759 ECF12 ECF12s10 Mycobacterium triplex

1 MLGCSDEETQPSSEITRLTIMSLSPPKPYLDDLATRFERDVIPLRDQLFR
51 AARRYTQSHADAEDLVQETMIKAYVGFASFREGTNLRAWLFTIMNHTRIN
101 HYRTAKRRPTEWLAGDVSDYLIPAGPPQATAGRLSAEAEVLDAIGDPEVR
151 QALQQLPESQQLAVYYADVEGFRYKEIGEILDIPLGSVMSRIHRGRKNMR
201 KLLLDFAIEQRYIREGDAVVAAA

>ECFp31113 ECF12 ECF12s10 Mycolicibacterium conceptionense

1 MPTVCLERPTNTQWYSGALGGAVTEGKVFPTMTDVEQAEPDAPQPTTETD
51 AELTARFERDAIPLLDQLYGGALRMTRNPADAEDLLQETMVKAYAGFRSF
101 REGTNLKAWLYRILTNTYINSYRKKQRQPAEYPTDEITDWQLASNAEHSS
151 TGLRSAEVEALEHCPTPRSRRRCSVARGVPDGGVLRRRRGFPYKEIAEIM
201 DTPIGTVMSRLHRGRKQLRDLLSDVARDRGFIRGQQLGAPEEVSS

>ECFp100116 ECF12 ECF12s10 Mycobacterium sp. 852002-50816_SCH5313054-b

1 MDARFEREVVPLREPVYRHALRMCRNHSDAKDLVQDAMVKAYSSFHSFTP
51 HTNLNAWLHRIQTNTYINGYRRKQRRPIQYSTEEFTEQQLAAHTWMGLRS
101 AEDEVLAALPDCEIKAAMRALPIQLRSVVYYADVEGFRYKQIAEIMGTPN
151 GTVMSRLYRGRRHLRRLLVEQVVR

>ECFp109409 ECF12 ECF12s10 Mycolicibacterium iranicum

1 MMSLESATPQDITGHLTAIPDETDVEMAARFVRDVIPLLNTLLGGAVRIT
51 PQRADAEDLVQETLVLAYKNFSTFQPGTNLKGWLFRIQANAHISGYRKRI
101 RRPAELPIAMNVDWQLPSDARHSPRALRSAEVEALEWWPDDEIRDALGAL
151 PSEFLMTVYYADVAGLTYREISEIMCTPMGTVMSRIHRGRSRLRVLLAGI
201 AADRGYVQEQKAG

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more