ECF proteins of ECF group ECF12

Displaying ECF 3221 - 3228 of 3228 in total
Name Aliases LCA Taxa Group Subgroup
ECFp31057
  • RNA polymerase subunit sigma
  • ASE48_19115
  • ... more
Mycobacterium sp. Root265 ECF12 ECF12s18

>ECFp31057 ECF12 ECF12s18 Mycobacterium sp. Root265

1 MTNLESAAPLQVTSYLAPIPAESDVELAARFERDVIPLLDTLFGGAMRLT
51 RQRADAEDLVQETLVRAYAGFRTFQQGTNLKGWLFRIQANAHINNYRKRM
101 RRPAELSVDTTLEWQLVADAGRSPRALRSAEVEVLELLPDNDIRNALDAL
151 PADFRMAVYYADVEGLAIKEIGAIMGTPLGTVMSRIHRGRSRLRVLLAGI
201 AADRGYRGAHNQAG

>ECFp61042 ECF12 ECF12s18 Mycobacterium

1 MRNECTEMSPDLTARFERDAIPLLDDLYGAARRLTRNRADAEDLVQETML
51 KAYRQFHTFREGSRLRAWLCRIMHNTWINNHRKLCCRPTEHLSGDIGDWQ
101 HLARRRHYEPSYCRPAELDALERVPDRKVIDALEALPETLRMTVYYADVH
151 GYRYREIADILDIPIGTVMSRLHAARRRLRESLADVARDHGFDRA

>ECFp61867 ECF12 ECF12s18 Mycobacterium sp. GA-2829

1 MARASQSPSDADDFGRIVLPLRPELLRAAMRLTGRTGDAEDLVQDTLVRA
51 YRSFGTFERGTNSRAWMHHILKNTWINNHRAAQRRPTEVPIDEVGAEATS
101 SSAASAEVSYLAGQPDSEVLSAMATLSDEFRMVVYLADVEGHPYAAVARM
151 MGTPLGTVMSRLHRARRQLRAQLGDTARRRRLVRAA

>ECFp62461 ECF12 ECF12s18 Mycobacterium sp. 1423905.2

1 MRSECHDADVELKMRFERDALPLLDDLYAAARRLTRDRTDAEDLVQDTML
51 RAYSCFHLFSDGSRLGAWLYRIMHNTWINNHRKSLSRPAEQLSADIADWQ
101 QANSRQHHDSAGCRAVELDVLERLPDQKIVEALEALPECFRATVYYADVH
151 GLRYREIAEILGIPIGTVTSRLSSARRRLRILLAEVANDRGLT

>ECFp63052 ECF12 ECF12s18 Mycobacterium sp. E2462

1 MRNECTEMSPDLTARFERDAIPLLDDLYGAARRLTRSRADAEDLVQETML
51 KAYRQFHTFREGSRLRAWLCRIMHNTWINNHRKLCCRPTEHLSGDIGDWQ
101 HLARRRHYEPSYCRPAELDALERVPDRKVIDALEALPETLRMTVYYADVH
151 GYRYREIAEILDIPIGTVMSRLHAARRRLRESLADVARDHGFDRA

>ECFp92577 ECF12 ECF12s18 Mycolicibacterium iranicum

1 MGASARFAEAVLPLVNDLLRVARRLTRNHADAEDLVQETMLKAFAGFSTF
51 QPGTNIKAWLLRIQSNTWISFYRARARRPEELLTGGLNDVESTRGQRLGP
101 SARSAEQAALDTVADDDVKNALEGLTEPQRLVLYLADIEGFRYKEIARIA
151 GVPLGTVMSRLHRARVAVRKHLLSLGDGRYADGRGL

Name Aliases LCA Taxa Group Subgroup
ECFp140387
  • RNA polymerase subunit sigma
  • RMCB_3365
  • ... more
Mycolicibacterium brisbanense ECF12 ECF12s18

>ECFp140387 ECF12 ECF12s18 Mycolicibacterium brisbanense

1 MPVTKPVPMSVRFERDALPLLDQLYGVARKYARSAADAEDLVQETMLKAY
51 ASFHTFEEGTNIRAWLFRILTNTWINSYRAAQRRPDEVLADTVTDAQLAA
101 VAARSTVELASAELAALESLGDDEVCRAVQSLPEFQRIVVYYADVVGFRY
151 KEIAEILDIPVGTVMSRLHRGRRELRGLLAEIAVARGYVGRDGSAGAAA

>ECFp61800 ECF12 ECF12s18 Mycobacterium grossiae

1 MVIVSPTAPSPMTAAEFAAGVAPLLPELRRAARRYATTPHDADDLLQETL
51 TRAWAGRGTFDGGAHLRAWLFRILVNTWISGHRRVERRPREALTETFDDV
101 AAAVLPTQPSAEFQAMRRLPDERLRAALASLPETLRTAMYYAAIEELPYR
151 DIADLEGIPVGTVMSRVHRARLRLRAALAVA

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more