ECF proteins of ECF group ECF12

Displaying ECF 3201 - 3220 of 3228 in total

>ECFp85203 ECF12 ECF12s7 Cytophagaceae bacterium SCN 52-12

1 MPVAMSKIVKEESTDDQRYHIFNKEFLPHIDSMYNFAFRLTMDEDDAHDL
51 VQDTYLKAFRFISSFEQGTNAKAWLFRILKNSFINDYRKRSKEPAKVDYQ
101 EIETTYNSEEGGEVQQTVDLRAHTVQDMIGDEVANALNSLPVDFRTVIII
151 CDIEGFTYEEMAKILDIPIGTVRSRLHRARNLLKEKLKNYATSMGYDT

Name Aliases LCA Taxa Group Subgroup
ECFp86173
  • RNA polymerase subunit sigma
  • G500_RS0109125
Hugenholtzia roseola DSM 9546 ECF12 ECF12s7

>ECFp86173 ECF12 ECF12s7 Hugenholtzia roseola DSM 9546

1 MCLLLPNCFFDSMSKLSYTDSEKRAIFEREFMPHTDSLYNFAYKLTFSED
51 DAKDLVQDAYLKAFRFIESFEQGTNAKAWLFRILKNSFINDFRKRKKEPA
101 KVDYQDLADTYDDTDAPDTAHTTDLRTTTMQNLIGDEVMTALNALSVDFR
151 TVVILCDLEGFTYEEMAVILDLPLGTVRSRLHRARTLLKDKLFEYAKKRG
201 YPTE

Name Aliases LCA Taxa Group Subgroup
ECFp88305
bacterium BRH_c32 ECF12 ECF12s7

>ECFp88305 ECF12 ECF12s7 bacterium BRH_c32

1 MTKKKQNIVKDAPSEKLYADFDREAVPHMNSLLNFALKLTKDEEDANDLL
51 QETYLRAFRFFDKFEKGTNCKAWLYRIMKNTFINDYRKILKEPNKVDYED
101 VQNFYETIKSNEVDTRHYEEDAFAGVLDDDITNAIASLSEDFRTVIILSD
151 IEGFTYDEIADFVDAPVGTVRSRIHRARKMLYTKLHGYAVKNGFIKDVA

Name Aliases LCA Taxa Group Subgroup
ECFp91265
Fabibacter sp. 4D4 ECF12 ECF12s7

>ECFp91265 ECF12 ECF12s7 Fabibacter sp. 4D4

1 MSEDVLQDEQEVQRQNYSEKEKTEIFDKEFMPHVDSMYNFGYRLTFDEDD
51 AKDLVQDTYLKAFRFINSFQRGTNAKAWLFRILKNSFINEFRKKSKQPSK
101 VDYNEVEQFYNSDDAGESITTDLRVETVQHMIGDEISGALNGIPVDFRTV
151 IILSDLEGFTYEEMSKILDIPIGTVRSRLHRARNMLKEKLAGYAKEMGYN
201 KES

Name Aliases LCA Taxa Group Subgroup
ECFp91511
  • RNA polymerase sigma factor RpoE
  • K384_RS05845
Thermonema rossianum DSM 10300 ECF12 ECF12s7

>ECFp91511 ECF12 ECF12s7 Thermonema rossianum DSM 10300

1 MITQPTKNMPYTREEKYRIFNEELLPHADAMYNSALRLTLDEDDAKDLVQ
51 ETYLKAFRFLDSFQQGTNAKAWLFRILKNSFINNFRKKSKEPAKVDYQEV
101 ESFYNSDEADNSRLSVTTDLRSETVQDKIGDEVATALNSLPVDFRIVIIL
151 CDIEGFTYEEMSKILDIPIGTVRSRLHRARNLLKEKLRDYAKKMGYLKNA

>ECFp91611 ECF12 ECF12s7 Bacteroidetes bacterium OLB8

1 MSAKHLSKKEDIFENELLPHVDALTTFAFHLTYNEEDARDLVQETFLKAY
51 KSIDSYAIGTNSKAWLFKILKNAYINEYRKKSKRPTEVDFEDFLAYLEKE
101 DLTIKGSQDFKLDMYQNLIGDEVTIAINSLPMDFKTVILLCDIEGFTYEE
151 ISKITDIPIGTVRSRLHRGRKMLRDKLRQYALKLGYKDSKSSGKKEK

>ECFp91938 ECF12 ECF12s7 Fabibacter misakiensis

1 MSEEALQDEHEVRRQNYSEMEKTEIFDKEFMPHVDSMYNFAYRLTFDEDD
51 AKDLVQDTYLKAFRFINSFERGTNAKAWLFRILKNSFINEFRKKSKQPAK
101 VDYNEVEQFYNSDDAGEQITTDLRVETVQHMIGDEISGALNGIPVDFRTV
151 IILSDLEGFTYEEMSKILDIPIGTVRSRLHRARNMLKDKLAAYAKEMGFN
201 K

>ECFp92979 ECF12 ECF12s7 Roseivirga seohaensis subsp. aquiponti

1 MNKENQGTQRQKYSEKEAARVFDQEFMPHVNSMYNFAYRLTFDEDDAKDL
51 VQDTYLKAFRFINSFEQGTNAKAWLFRILKNSFINEFRKKSKQPAKVDYN
101 EVESYYNSDDVDESITTDLRVETVQHMIGDEITLAMNSIPVDFRTVIILS
151 DLEGFTYEEMSKILDIPIGTVRSRLHRARNMLKEKLSSYAKEMGYNK

Name Aliases LCA Taxa Group Subgroup
ECFp95055
  • RNA polymerase sigma factor RpoE
  • PL77_RS13305
Flammeovirga sp. OC4 ECF12 ECF12s7

>ECFp95055 ECF12 ECF12s7 Flammeovirga sp. OC4

1 MNNDSKKKKSPNTTAQRLIIFDREFAPHTDSMYSFAFRLTGNDEDAKDLV
51 QDAHMKAYRFIDSFEIGTNAKAWLFRILKNSFINEYRKKSKEPSKIDYNE
101 VETVYSGERDDPSLVAGLKQENSKYKIGDEVTGALNALAVDFRIVIILCD
151 IEGFTYEEMSKILDIPIGTVRSRLHRARNLLKEKLEDYAKKMGYYQKKAN

Name Aliases LCA Taxa Group Subgroup
ECFp672
  • RNA polymerase sigma factor RpoE
  • rpoE
  • ... more
Cytophaga hutchinsonii ATCC 33406 ECF12 ECF12s7

>ECFp672 ECF12 ECF12s7 Cytophaga hutchinsonii ATCC 33406

1 MEEQNSKTRYKSKEEKDSLFEKEFMHLLGPLYNFGYRLTLDEDDANDLVQ
51 ETYLKAYRFFDSYEKGTNAKAWLFRILKNTFINEYRRKTKEPNKVDYQEV
101 ESYYNSDEVNEPITSDLRVDSLNNMIGDEVANALNALDVDFRTIIILCDL
151 EGFTYEEMAKILDIPIGTVRSRLHRARNVLKEKLQEYAQSMGYKDQRKKH
201 D

Name Aliases LCA Taxa Group Subgroup
ECFp90445
  • RNA polymerase sigma factor RpoE
  • RNA polymerase, sigma subunit, ECF family
  • ... more
Leadbetterella byssophila DSM 17132 ECF12 ECF12s7

>ECFp90445 ECF12 ECF12s7 Leadbetterella byssophila DSM 17132

1 MEEEEIEVSKPKYTDEEKHRIFNQEFMPQIDSMYNFAYRLTNDEDDANDL
51 LQDTYMKAFRFINSFQQGTNAKAWLFRILKNSFINDYRKKSKEPSKIDYQ
101 EVETVYNSNEDAEVESTTDLRIEAVQDLIGDEVATALNSLPVDFRTVIIL
151 CDIEGFTYEEMAKILDIPIGTVRSRLHRARNLLKEKLRSYAKSMGYKELR

Name Aliases LCA Taxa Group Subgroup
ECFp31103
  • RNA polymerase sigma factor RpoE
  • N008_11220
  • ... more
Hymenobacter sp. APR13 ECF12 ECF12s7

>ECFp31103 ECF12 ECF12s7 Hymenobacter sp. APR13

1 MSDSPERVPKLSKEEKDRRFQAELMPVIDSLYNFAFRLTLDEDDANDLVQ
51 ETYLKAYRFFEYFEQGTNAKAWLFRILKNSFINDFRKKSKQPAKVDYSEI
101 EGYYNSEDVESDSDAGGTSSDMRQQAVRDLIGDEVASALNSLPVDFRTVI
151 ILCDLEGFTYEEMAKVLDIPIGTVRSRLHRARNFLKDKLEKYAQSMGYGA
201 DSGNTEAEPEDDTDNY

>ECFp31188 ECF12 ECF12s7 Bacteroidetes bacterium OLB12

1 MSEERIKQSYTKQEKQAVFDNEFLPHINSMYNFGFRLTLDPDDAKDLVQD
51 TYLKAYRFIESFQKGTNAKAWLFRILKNSFINDYRKKTKEPSKVDYQEVE
101 TYYNSEDVNRQITPDLRVESLQDMIGDEISNALNSLDVDFRTVIILCDLE
151 GFKYEEMAKILDIPIGTVRSRLHRARNLLKEKLSEYAKSMGYKNTEL

>ECFp31269 ECF12 ECF12s7 Chlorobi bacterium OLB5

1 MKKNNSKNIKDIAKEEVLSPEILPENDEFSESDENLAEDNPLDKLNQAEL
51 DARKRDFEAEAIPHMKLLYNYALRMTGDQLEADDLVQDTFMRAFRFFHKF
101 ERGTNCKAWLFRIMKNCYINKYRKTKKEPSKVDYEDVQNFYDSIRDDVVD
151 PNDLEHKVFSNLLDDELMSALNSLQDDYKTVVILCDLEGLSYEEIAEFLD
201 VPIGTVRSRLHRGRKILQKKLQDYAKARGYSVESMA

Name Aliases LCA Taxa Group Subgroup
ECFp30946
Rufibacter ruber ECF12 ECF12s7

>ECFp30946 ECF12 ECF12s7 Rufibacter ruber

1 MSEQRGNSMSKEEKDARFEAELMPVISSLYNFAFRLTLDEDDANDLVQET
51 YLKAYRFFDYFEPGTNAKAWLFRILKNSFINDFRKKSKQPAKVDYSEVEG
101 YYNSEDVDAEGEGSSGTTDLRMESVQDLIGDEVAGALNSLPVDFRTVIIL
151 CDLEGFTYEEMAKILDIPIGTVRSRLHRARHFLKEKLEKYAKSMGYNS

>ECFp63590 ECF12 ECF12s18 Mycobacterium sp. 1165549.7

1 MPSSATHSNPRGVDDLVARFEQEALPWLDQLYRAARRYTRTHTDAEDLVQ
51 ETLLRAYVGFRSFKEGTNIRAWLFTIMNNAWINNHRTATRRPNEWLSGEI
101 GDVSVSVRTPHWRSGQLSAECEALELLGDDEVRDALQKLPEGQRMALYYA
151 DVEGLRYKEIAAVLEMPLGSVMSRIHRGRRNLRTLLADYAIQRGYLRAPD
201 AVIAA

>ECFp103659 ECF12 ECF12s18 Mycolicibacterium obuense

1 MSDHPHRRTADEADGTVGASARFAEAVLPLVNDLLRVARRLTRNNADAED
51 LVQETMLKAFAGFSTFQPGTNIKAWLLRIQSNTWISFYRARARRPEELLT
101 GGLNDVESTRGQRLGPSARSAEQAALDTVADDDVKNALEGLTDPQRLVLY
151 LADIEGFRYKEIARIAGVPLGTVMSRLHRARVAVRKHLLSLGDGRYADGR
201 GL

>ECFp181914 ECF12 ECF12s18 Mycobacterium sp. 27335

1 MLRACAGDLVGPPAATLSIELTARFERDALPLRERLFRGALRLTNSRQDA
51 EDLVQETMLRAYRGFHTFEEGTNLNAWMFQIMHNAGISRHRKAQRRPAEV
101 LVGDFAAPALTEQSPRLGRGLRSAEVSALEHFPDDEIRSALMGLSEEYRL
151 TIYLADVEGLPYKEIAQVTGVPAGTVMSRVHRGRQQLRSALSSLARRRRI
201 IGDLGSDARRQSCG

>ECFp182109 ECF12 ECF12s18 Mycobacterium sp. SWH-M5

1 MTTHPGGTQDLPMATVDSTAAGEPSPVFRDPDLSVRFANGVVPLLNQLHK
51 RARRMTRNAVDAEDLVQETMLRAYSGYCTFTEGTNLRAWLFHIMTNTYIN
101 GLRRGSRRPSEYLCDHITDQQLARRGENVPAGSRSAELDALDALPDIELA
151 DALATLPPQFRLAIYYRDVVGLSYREIAEVMACCEGTVMSRLYRGRRRLR
201 VLLADTPERA

>ECFp30556 ECF12 ECF12s18 Mycobacterium sp. 852013-50091_SCH5140682

1 MASGYEVARTGSTTNGRSGAMPVTKPVPMSARFERDALPLLDQLYGVARK
51 YARSAADAEDLVQETMLKAYASFHTFEDGTNIRAWLFRILTNTWINSYRA
101 AQRRPDEVLADTVTDAQLAAVAARSTVELASAELAALEALGDDEVCHAVQ
151 SLPEFQRIILYYADVVGFRYKEIAEILQIPVGTVMSRLHRGRRELRGLLA
201 EIAVARGYVGRDGSSGAAA

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more