ECF proteins of ECF group ECF12

Displaying ECF 1 - 20 of 3228 in total

>ECFp62093 ECF12 ECF12s9 Mycobacterium sp. E802

1 GEQIERGARRLTHNRYDAEDLVQETLLKAYSGFHTFKPGSNARAWLFRIM
51 YNTWINSYRTTQRRPEEVLAESVTDAQLAAALAGSPIELASAELAALESM
101 GDDEVRRAMEALPDFQRVIVYYADVACFRYKEIAELMDIPVGTVMSRLHR
151 ARRNLRKLLAETAVARGYLARSQDNGTAA

>ECFp144962 ECF12 ECF12s9 Mycobacterium

1 MYKSGGCLRLNNNTEPLPDSQDATRFVNTVLPCIEQIRGRARRLTTNTYD
51 AEDLIQETMLKAYSGFHTFQPDSNARAWLFRIMYNNWVSTYRTRQRGVAE
101 QLCDEFTDWQLSAEARHTSSGLRSAEVEALETMRDDEIADALRAIPAVNR
151 VTVYLADVEGYPYREIATLMGTPIGTVMSRLARGRRRLRELLDDVAKDRG
201 IIRVPAGGPGPSPQSTR

>ECFp62221 ECF12 ECF12s9 Mycobacterium sp. E802

1 VEQIERGARRLTHNRYDAEDLVQETLLKAYSGFHTFKPGSNARAWLFRIM
51 YNNWINSYRARQRAVGEQLCEDITDWQVSAEGRHTSSGLRSAEVEALEAM
101 RDDDIADALDAIPAANRMTVYFADVACFRYKEIAELMDIPVGTVMSRLHR
151 ARRNLRKLLAETAVARGYLARSQDNGTAA

>ECFp62497 ECF12 ECF12s9 Mycolicibacterium setense

1 MHLSGGAPSLNKATEPLPDRQDATRFVDTVLPCIEQIRGRARRLTTSRYD
51 ADDLMQETLLKAFSGFHTFEPGSNARAWLFRIMYNNWVNMYRMRQRGVCE
101 QLCEDFTDWQLSAEARHTSLGLRSAEVEALEAMRDDEIADALAAIPAVNR
151 VTVYLADVEGYPYREIASLMGTPVGTVMSRLARGRKRLRELLSDVAKDRG
201 LVRAPAGGPNPRPRLTDPQHVR

Name Aliases LCA Taxa Group Subgroup
ECFp63303
  • hypothetical protein
  • QQ25_RS03065
Mycolicibacterium setense ECF12 ECF12s9

>ECFp63303 ECF12 ECF12s9 Mycolicibacterium setense

1 MTEPLPDQQDATRFVNTVLPCIQQIRGRARRLTTNSYDAEDLLQDTLLKA
51 YSGFHTFQPDSNARAWLFRIMYNNWVNMYRTRQRGVCEQLCEDFTDWQLS
101 AEARHTSLGLRSAEVEALEAMRDDEIADALAAVPAVNRVTVYLADVEGYP
151 YREIASLMGTPVGTVMSRLARGRKRLRELLSDVAKDRGLVRAPAGGPNPR
201 PRLTDPQHVR

>ECFp64870 ECF12 ECF12s9 Mycolicibacterium vulneris

1 MLYICREVCVRLNSDTEPPAGSQDATRFLDTVVPCIEQIRGRARRLTANP
51 YDAEDLIQETMLKAYSGFHTFQADSNARAWLFRIMYNNWINTYRARQRGV
101 AEQLCEDFTDWQLSAEARHTSSGLRSAEVEALETMRDDEIADALSAIPAV
151 NRVTVYLADVEGYPYREIASLMGTPIGTVMSRLARGRRRLRELLNDVAKD
201 RGIIRVPADGPGPLPQSTR

>ECFp65085 ECF12 ECF12s9 Mycobacterium sp. URHD0025

1 MSIDVEPLSDRRDNSVFVDTVLPCIEQIRGRAQRLTTSRYDADDLMQETL
51 LKAFSGFHTFEPGSNARAWLFRIMYNNWVNMYRTRQRGVSEQLCEDFTDW
101 QLSAEARHTSVGLRSAEVEALEAMRDDEIADALRAIPAVNRVTVYLADVE
151 GYPYREIASLMGTPIGTVMSRLARGRKRLRELLNDVARDRGLVRAPAGGP
201 NPRP

>ECFp64405 ECF12 ECF12s9 Mycolicibacterium goodii

1 MRVEYVNRSATSARDATEFIAAALPCIEAIERGARRLTANQFDAEDLVQE
51 TLLNAYNGFHTFEGGTNMQAWLFRIMRNTWISGYRSRQRNPVELLCEDFT
101 DAQLSAGMRLTSTAPRSAENEVLAHLPDDAIADALRALPHANRMVVYYAD
151 VQGYAYREIASLMGTPVGTVMSRLARGRARLRTLLADVAEERGLTDRHAA
201 VPAGRARYPLL

>ECFp168402 ECF12 ECF12s9 Mycolicibacterium conceptionense

1 TFQPDSNARAWLFRIMYNNWVNTYRTAQRRPQEVFADELTDAQLAEVAER
51 FPLGVVSAELAALESMGDDDVRQAMRALPESQGIVVYYADVAGFRYKEIA
101 EILQIPVGTVMSRLHRGRRNLRTLLVGAEVAGGYVGNRMPCAAA

>ECFp100566 ECF12 ECF12s9 Mycolicibacterium conceptionense

1 MTTNPYDAEDLLQDTMLKAFSGFHTFQPDSNARAWLFRIMYNNWVNTYRA
51 RQRSVAEQLCEDFTDWQLSAEACHTSTGLRSAEVEALEAIRDDEVADALR
101 AIPAVNRVTVYLADVAGFRYKEIAEILQIPVGTVMSRLHRGRRNLRTLLV
151 GAEVAGGYVGNRMPCAAA

Name Aliases LCA Taxa Group Subgroup
ECFp106893
  • RNA polymerase sigma factor RpoE
  • RMCB_5906
Mycolicibacterium brisbanense ECF12 ECF12s9

>ECFp106893 ECF12 ECF12s9 Mycolicibacterium brisbanense

1 MIKAYSGFHTFTPGTNLKAWLSRIMTNTHISGYRRSQRQPISYSMEGLSD
51 EELVNHAQRSGAGPVSAEDEALAALPHTEINAALQALPRQFRAVVYYADV
101 EGMPHRDIADIMGTPRGTVMSRIARGRQHLRRQLTAVP

Name Aliases LCA Taxa Group Subgroup
ECFp111129
  • hypothetical protein
  • TX88_RS05110
Mycolicibacterium septicum DSM 44393 ECF12 ECF12s9

>ECFp111129 ECF12 ECF12s9 Mycolicibacterium septicum DSM 44393

1 MLPCIEQIRGRARRLTTNTYDAEDLIQETMLKAYSGFHTFQPDSNARAWL
51 FRIMYNNWISTYRTRQRGVAEQLCEEFTDWQLSAEARHTSAGLRSAEVEA
101 LETMRDDEIADALCAIPAVNRVTVYLADVEGYPYREIAALMGTPIGTVMS
151 RLARGRRRLRELLDDVAKDRGIIRVPAGDPGPLPQSTR

>ECFp115766 ECF12 ECF12s9 Mycobacterium sp. E802

1 LKAYSGFHTFKPGSNARAWLFRIMYNNWINSYRARQRAVGEQLCEDITDW
51 QVSAEGRHTSSGLRSAEVEALEAMRDDDIADALDAIPAANRMTVYFADVE
101 GYHYREIAALMGTPVGTVMSRLARGRKRLRELLADVARDRGIGRDAGKVQ
151 AAVPLS

>ECFp62148 ECF12 ECF12s9 Mycolicibacterium conceptionense

1 MEQIRGRARRLTTNPYDAEDLLQDTMLKAFSGFHTFQPDSNARAWLFRIM
51 YNNWVNTYRARQRRPQEVFADELTDAQLAEVAERFPLGVVSAELAALESM
101 GDDDVRQAMRALPESQGIVVYYADVAGFRYKEIAEILQIPVGTVMSRLHR
151 GRRNLRTLLVGAEVAGGYVGNRMPCAAA

>ECFp182063 ECF12 ECF12s9 Mycobacterium sp. SWH-M5

1 MRVECVKPPAASTRDATEFIAAALPCIDVIERGARRLTANRFDAEDLVQE
51 TLLKAYNGFHTFDDGSNMQAWLFRIMRNTWISGYRSRQRNPVEQLCEDFT
101 DAQLSAGLRHTSTGPQSAENEALAALPDDTIVAALQAIPRSYRTVVYYAD
151 VEGYSYREIAALMGTPIGTVMSRLARGRARLRTLLADVAEERGISADHAA
201 VPAGRTRYPVA

>ECFp181806 ECF12 ECF12s9 Mycobacterium sp. NS-7484

1 VEQIERGARRLTHNRYDAEDLVQETLLKAYSGFHTFKPGSNARAWLFRIM
51 YNNWINSYRARQRAVGEQLCEDITDWQVSAEGRHTSSGLRSAEVEALEAM
101 RDDDIADALDAIPAANRMTVYFADVEGYHYREIAALMGTPVGTVMSRLAR
151 GRKRLRELLAETAVARGYLARSQDNGTAA

>ECFp61547 ECF12 ECF12s9 Mycolicibacterium vulneris

1 MRLNSDTEPPAGSHDATRFLDTVVPCIEQIRGRARRLTANPYDAEDLIQE
51 TMLKAYSGFHTFQADSNARAWLFRIMYNNWINTYRARQRGVAEQLCEDFT
101 DWQLSAEARHTSSGLRSAEVEALETMRDDEIADALSAIPAVNRVTVYLAD
151 VEGYPYREIASLMGTPIGTVMSRLARGRRRLRELLNDVAKDRGIIRVPAD
201 GPGPLPQSTR

>ECFp61607 ECF12 ECF12s9 Mycolicibacterium vulneris

1 MVPCIEQIRGRARRLTANPYDAEDLIQETMLKAYSGFHTFQADSNARAWL
51 FRIMYNNWINTYRARQRGVAEQLCEDFTDWQLSAEARHTSSGLRSAEVEA
101 LETMRDDEIADALSAIPAVNRVTVYLADVEGYPYREIASLMGTPIGTVMS
151 RLARGRRRLRELLNDVAKDRGIIRVPADDPGPLPQSTR

Name Aliases LCA Taxa Group Subgroup
ECFp61699
Mycobacterium sp. 141 ECF12 ECF12s9

>ECFp61699 ECF12 ECF12s9 Mycobacterium sp. 141

1 MSECDVASASTPAFDDAETAARFVAEALPHLDQIRRGAYRLTTSKYDAED
51 LVQETLLKAYSGFHTYQPDTNMRAWLFRIMQNTWTSAYHARQRRPNELLC
101 EGLSDWQLLDERIFTPVGLRAAEIEAMTTSYDDEIIRALKAIPLQNRMAV
151 YFADIEGYQYREIAAMMGTPVGTVMSRLARGRSRLRALLSECRRRTQGGG
201 TEQPT

>ECFp61727 ECF12 ECF12s9 Mycolicibacterium wolinskyi

1 MHTECEPRTADPSGATDFVEAILPCIDQIERGARRLTPNKYDAEDLVQET
51 LLKAYSGFHTFRQGSNVRAWLFRIMYNTWVSRYRARQRGPNEQLCEDFTD
101 GQLSAEAGHTAAGLRSAEVEALEALRDDEIADALAAIPAANRMVVYYADV
151 EGYQYREIASLMGTPVGTVMSRLNRGRRRLRELLADVAYERGMARHSATC

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more