ECF proteins of ECF group ECF11

Displaying ECF 1 - 20 of 1602 in total
Name Aliases LCA Taxa Group Subgroup
ECFp113980
  • RNA polymerase subunit sigma
  • ASF43_11110
  • ... more
Pseudorhodoferax sp. Leaf267 ECF11 ECF11s3

>ECFp113980 ECF11 ECF11s3 Pseudorhodoferax sp. Leaf267

1 MSVVPEAAPRSGVPTPDQLALWIRDVAHAGDREAFSALFLHFAPRVKSYL
51 LRAGAGDEQAEDLAQETLVMLWRKAALFDARQAGASTWVFTIARNLRVDR
101 FRRQGGAAALQVDDTDMDTLLGDDPAPETRLHTVRMERHVRLAMGQLPPE
151 QAQVLQLSFYDDEPHARIASLLGIPLGTVKSRVRLAVAHLRRLLAQFDDS
201 TP

>ECFp115688 ECF11 ECF11s3 Brevundimonas sp. Leaf280

1 MKALDSLPDPLLHDRLIEQIALRRDRDAFAALFAYFAPRLKAWLIKSGAT
51 PGAAEDFAQDAMLTVWRKADLFDSSKARAATWIFTIARNRRLDMLRRDAR
101 PLPTPEIELAGDDVRRPDELLSMSQDADRVRDALARLSADHVEVLRLAFF
151 MDNSHSEIAKHLGLPLGTVKSRIRNAMTKLRLILAPSEDAAR

Name Aliases LCA Taxa Group Subgroup
ECFp130063
Azospirillum sp. B510 ECF11 ECF11s3

>ECFp130063 ECF11 ECF11s3 Azospirillum sp. B510

1 MPGPMFPLNGRMQDQHTPAADTAPSLEDRLVAVGRARDKQAFGVLFDHFA
51 PRLKTYLRRLGCDAGAAEELVQEVMLLVWRRAETYDPVHASAGTWVFTIA
101 RNKRIDALRREQRPEIDPDDPALVPEPQESADRRIEAKESGGRLRAALKE
151 LPPEQAELLRMAYFEDKPHSVISVEHGIPLGTVKSRLRLAMDRLRRSLKD
201 VG

>ECFp130106 ECF11 ECF11s3 Mesorhizobium

1 MRDEGSLSAPEATRLMAAVAANRDRVAFAALFGFYAPRLKAFLKRSGMTP
51 SAAEDVVQETMLLVWKKASYFDPARAGVSTWIFTIARNARIDRLRRESRP
101 AVIAEAFDPSDQPDAPVSGEQAIIAVEREDRVREALDLLPREQADILKMS
151 FFGEVTQSEIADAIGIPLGTVKSRVRLALGRLRQILDDLK

>ECFp130141 ECF11 ECF11s3 Magnetospirillum magnetotacticum MS-1

1 MPDKRLAVEPGPGAERFSDLLSAVAQYGDRQAFALLFQYYAPRLKTYMRK
51 LGAEDAVAEELAQEAMLAVWRKAASFDPGRANAGTWIFAIARNLRIDMLR
101 KEKRPEIDFDDPELVPDPAPRADEVMATQQSESRVRAAMSGLSAEQTEVV
151 TLSFYEDTPHAEIAARLKIPLGTVKSRLRLAMKRIRSELGDDQP

Name Aliases LCA Taxa Group Subgroup
ECFp130282
  • RNA polymerase sigma factor
  • RD2015_2461
Roseateles depolymerans ECF11 ECF11s3

>ECFp130282 ECF11 ECF11s3 Roseateles depolymerans

1 MTGRAAWARIARVAIVSWISDDPNRHLTRIGCMGTLRRDSLAQTPAEPPG
51 TTALPKPSPSAVPHLKIVSLHGEPPLDPLRGQPPGGGGAAEDPAKDPANF
101 APGSASASVEAAAPGVSAVSGDEWSQLTRRIAEHKDRDAFARLFQHFAPR
151 VKSYLMRTGSSEQMAEDLSQEALVTVWRKAALFDPAQAAVSTWIFTIARR
201 LRIDAARRHRLEDTGDESYDFDRLEADQRDVGEHTDAVRLSRRIRDALGR
251 LPAEQAQVLRLSYYDDEPHARIAAELGLPLGTVKSRIRLAVAQLRKMLDA

>ECFp130477 ECF11 ECF11s3 Fodinicurvata fenggangensis DSM 21160

1 MTLADPSAEMRRDHHAALIRAVAGHGDRTAFAELFDHFAPRVKSYLIRLG
51 ANDGLAEELVQEVMIMIWRKAASFDPAQASVSTWVFTIARNKRIDSLRRD
101 RRGELDSEDPALHPEAEPSADIRVEAREDSERIRAALDQLPPEQAALIRM
151 AYFEDKAHGAIALESELPLGTVKSRLRLALGRLRKALKEDHIE

>ECFp130534 ECF11 ECF11s3 Alphaproteobacteria bacterium RIFCSPHIGHO2_12_FULL_63_12

1 MVSEPNSPAADFSTAETMSALLRRVAADGDRDAFNALFVFFAPRIKGYLM
51 KIGAAADLADDLAQEAMLRVWRKAKLFDPAKASASTWIFAIARNLRIDAA
101 RRASKPALDGDEPTLAPEPEMLADKKIEIAARDERIREAFGALPPAQHEV
151 VRLHFIEDMTHSEIAAHLGLALGTVKSRLRLAFEKIRKDLGDAVE

Name Aliases LCA Taxa Group Subgroup
ECFp130700
Kaistia sp. SCN 65-12 ECF11 ECF11s3

>ECFp130700 ECF11 ECF11s3 Kaistia sp. SCN 65-12

1 MQAVAAHDRSAFAALFGYFAPRVKAFLMRSGLSANMAEEVTQETMLAIWH
51 KASYFDPSRAGVSTWIYAIARNQRIDRLRRERTHTVGPHLDPSDEPELPD
101 SGEDIALVAEREAQVRTALAALSREQAAIVHLSFFAEKPHSEIARELGVP
151 LGTVKSRIRLALNRLRALLGDET

Name Aliases LCA Taxa Group Subgroup
ECFp130824
  • RNA polymerase subunit sigma
  • XAN126_RS0109385
Xanthobacter sp. 126 ECF11 ECF11s3

>ECFp130824 ECF11 ECF11s3 Xanthobacter sp. 126

1 MSVQPAEPRVAASGAELSALIVAIATRADREAFGRLFRHFAPRVKSYLVR
51 NGLSANAAEELAQETLLTVWRKAAYFDPTRAAASTWIFTIARNLSIDLKR
101 RERYGDTYKAETHEDEVDETSGETILMTAEREARVRAALAKLSEEQATIV
151 RLSFFQEKPHSQIAQELGIPLGTAKSRVRLALNRLRALLEDLK

Name Aliases LCA Taxa Group Subgroup
ECFp130835
  • hypothetical protein
  • ASF44_18165
  • ... more
Pseudorhodoferax sp. Leaf274 ECF11 ECF11s3

>ECFp130835 ECF11 ECF11s3 Pseudorhodoferax sp. Leaf274

1 MSPQQPQPSAPTEPVASGLRPSHLSIVPPPGSRSAVPSPEDLAHWLNAVA
51 QAGDRQAFGQLFAYFAPRIKSYLLRAGTDDALAEDLAQETMVLLWRKAAL
101 FDAAQAGAATWVFTIARNLRVDRFRRQGGAAALQADDVDIDTLAHAAPEP
151 ATQLHAQRMERQVQAALRQLPPEQALVLQLSYYEDQPHARIAERLGIPLG
201 TVKSRVRLAVNHLRRLLAAFEDPAP

Name Aliases LCA Taxa Group Subgroup
ECFp131023
  • RNA polymerase sigma factor RpoE
  • K328_RS24125
Nisaea denitrificans DSM 18348 ECF11 ECF11s3

>ECFp131023 ECF11 ECF11s3 Nisaea denitrificans DSM 18348

1 MTHDQLIEAIAESQDKMAFRQLFEHFAPRLKSYLLRLGADPATAEDVAQE
51 AMVMVWRKAASFDRRQAGASTWIFTIARNKRIDRLRRERRPELDPEDPGL
101 VPAAEPAPDRSLQDTQARRHIASAMRALPDEQAELVRRAFFDDESHSRIA
151 EESGLPLGTVKSRIRLALTRLRHEMKEFE

>ECFp155445 ECF11 ECF11s3 Bradyrhizobium sp. OK095

1 MRHEAESITPQKAANFVRAIAARRDREAFKQLFNFYAPRIKTMLMRGGAA
51 GEIAEDLAQETLITVWRKADGYDPQRAAVSAWIFTIARNLRIDRFRKDQR
101 AQLHHVYELMLPAAEDPPDVPFEAAERESRVRAALEGLPEDQVRVVELSF
151 FEGNAHGDIAKKLGIPLGTVKSRLRLAMARLRDFLGENS

Name Aliases LCA Taxa Group Subgroup
ECFp168170
Brevundimonas sp. 374 ECF11 ECF11s3

>ECFp168170 ECF11 ECF11s3 Brevundimonas sp. 374

1 MNGLRVAVMFGSRLIQTFPLSVLVFMHAEPLSFASTPCRSNRVKALDSLP
51 DPLLHDRLIEQIALRRDRDAFAALFAYFAPRLKAWLIKSGATPGAAEDFA
101 QDAMLTVWRKADLFDSSKARAATWIFTIARNRRLDMLRRDARPLPTPEIE
151 LAGDDVRRPDELLSMSQDADRVRDALARLSADHVEVLRLAFFMDNSHSEI
201 AKHLGLPLGTVKSRIRNAMTKLRLILAPSEEAAR

Name Aliases LCA Taxa Group Subgroup
ECFp168405
Bosea sp. BIWAKO-01 ECF11 ECF11s3

>ECFp168405 ECF11 ECF11s3 Bosea sp. BIWAKO-01

1 MVTALALRVDEMRRARTVAQRGRFVTLFDPNALIAAIARSGDRAAFAALF
51 DHFAPRVKGLLMKGGAPADLAEDMAQETLLAVWRKAALFDPAKASAGTWI
101 ATIARNLRIDVARRETRSRLSQIYEIIDEDGPEQPDDVVSGAQRDARVRA
151 AMTDLSPDQYRVIELAFLEGFTHQDVAQRLAIPLGTVKSRLRLALSHLRG
201 KLEDLR

Name Aliases LCA Taxa Group Subgroup
ECFp181486
Variovorax sp. KK3 ECF11 ECF11s3

>ECFp181486 ECF11 ECF11s3 Variovorax sp. KK3

1 MRTARQPAITSARPLASATPWLSIVTKEQPRGFVPSSEELNTWLRAVALA
51 ADRQAFAALFKHFAPRVKAYLMLRGASEPLAEELTQEAMVSVWRKAATFD
101 PARAGASTWIFTIARNLRVDHLRRQGNHLLSDDDEQASQMLDPLPALDDQ
151 VLAREREARVRKAMSRLSEEQAQILRLSFFEEHPHAQIAQELGLPLGTVK
201 SRARLAISHLRRLLEGLES

Name Aliases LCA Taxa Group Subgroup
ECFp181503
Acidovorax cattleyae ECF11 ECF11s3

>ECFp181503 ECF11 ECF11s3 Acidovorax cattleyae

1 MTIVRKPLAEQPPPRTASALPPYLSIVSKYHTEGLPSSPSSEAWIALVRA
51 VADHGDRQAFAALFKHFAPRVKAYLMRLGLAEGVAEDLAQEAMVNLWRRA
101 ATFDPAHAGVSTWVFTIARNLRIDHLRRKSNQLCDSDEGLDIAVDGDGPE
151 ELTYAAQCENDVRRAMESLAPEQAQVLRRSFFEDQPHARIAEDLGIPLGT
201 VKSRVRLAVRHLHRLLGAHAP

>ECFp181549 ECF11 ECF11s3 Pseudacidovorax sp. RU35E

1 MIQSAAGCVKAYIMEARYQPSNVPPPRKRPLPVSIVNLADAQAVLPTSAE
51 LCDLVRAVAERQDRTAFAVLFKHFAPRIKTYLMRSGAEPDAAEDLAQETM
101 VALWRKAALFDARQAGVSTWVFTIARNLRVDRYRRQGGAVEVLSAEQADL
151 DSMPEDAPAPDERLHARRCEHRLREALRRLSPDQVRVLHLSYFEDQPHAR
201 IADELGIPLGTVKSRVRLAVAHLRKLLDGLA

>ECFp181548 ECF11 ECF11s3 Phyllobacterium sp. OV277

1 MIRLRCICVQSGMDDFGTLTFGNFNGRWLRARRSMPKAGKTKSAIRRSFQ
51 AMTEAVNYSAKITRIAAHGDKVAFAEIFAYFAPRIKGFFMRGGMAPGQAE
101 ELAQETMLTVWRKAQLFDSTKASASTWIFTIARNLRVDAIRRERYPAAHL
151 MEEHEPEFESSPSDDLLRVESEERVRRAMRELSSDQMNVIQLHYFDDKPH
201 SEIARALDLPLGTVKSRLRLAMQHLRNLLGEE

Name Aliases LCA Taxa Group Subgroup
ECFp86210
  • hypothetical protein
  • A3OO_RS0113660
Methylocystis rosea SV97 ECF11 ECF11s3

>ECFp86210 ECF11 ECF11s3 Methylocystis rosea SV97

1 MIGAVATQTVEIPDRRAVAESRLREASTMTLRTAPAALSSAEATSLIRRI
51 AETQDRGAFAALFAYYFPRVKAYMLRVGASPAGAEEFAQEALLRVWRKAD
101 SFDPRAAAASTWIFVIARNLRIDRLRGERNIDGFERDPSEEPDAPPSGEA
151 IAIMNERRSRLHAALAALPAEQAHIIELFYFEEHPQSEIARMLGVPLGTV
201 KSRVRLAVQRLRAELEDLGS

Cookies help us deliver our services. By using our services, you agree to our use of cookies. Learn more